@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv3581c: (2016-05-21 )
MNQLPRVGLGTDVHPIEPGRPCWLVGLLFPSADGCAGHSDGDVAVHALCDAVLSAAGLGDIGEVFGVDDPRWQGVSGADMLRHVVVLITQHGYRVGNAVVQVIGNRPKIGWRRLEAQAVLSRLLNAPVSVSATTTDGLGLTGRGEGLAAIATALVVSLR

Atome Classification :

(81 SA) .........10.......----.20........30........40........50........60........70........80........90........100.......110.......120...---.---.---..130.......140.-......150.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNQLPRVGLGTDVHPIEP----GRPCWLVGLLFPSADGCAGHSDGDVAVHALCDAVLSAAGLGDIGEVFGVDDPRWQGVSGADMLRHVVVLITQHGYRVGNAVVQVIGNRPKIGWRRLEAQAVLSRLLN---A---P---VSVSATTTDGLGLTGR-GEGLAAIATALVVSLR
114 HHSearch 97.2675%-147 - C11 -2UZH ? A:[5-159] ---LPRVGLGTDVHPIEA----GRPCRLLCLEFDDADGCA--SDGDVAAHALCDALLSAAGLGDLGTIFGTDRPQWRGASGADMIRHVRGLVENAGFVIGNATVQVIGNRPKVGPRREEAQQVLSELVG---A---P---VSVSATTTDGLGLTGR-GEGLAAIATALVAAE-
21 PsiBlast_CBE 93.2875%-140 - C11 -2UZH ? C:[5-148] ---LPRVGLGTDVHPIEA----GRPCRLLCLEFDDADGCAGHSDGDVAAHALCDALLSAAGLGDLGTIFGTDRPQWRGASGADMIRHVRGLVENAGFVIGNATVQVIGNRPKVGPRREEAQQVLSELVG---A---P---VSVSATTTDGLGLTGR-GEGL------------
1 PsiBlast_PDB 93.1375%-144 - C11 -2UZH ? A:[5-148] ---LPRVGLGTDVHPIEA----GRPCRLLCLEFDDADGCA--SDGDVAAHALCDALLSAAGLGDLGTIFGTDRPQWRGASGADMIRHVRGLVENAGFVIGNATVQVIGNRPKVGPRREEAQQVLSELVG---A---P---VSVSATTTDGLGLTGR-GEGL------------
22 PsiBlast_CBE 92.3575%-143 - C11 -2UZH ? B:[5-148] ---LPRVGLGTDVHPIEA----GRPCRLLCLEFDDADGCA--SDGDVAAHALCDALLSAAGLGDLGTIFGTDRPQWRGASGADMIRHVRGLVENAGFVIGNATVQVIGNRPKVGPRREEAQQVLSELVG---A---P---VSVSATTTDGLGLTGR-GEGL------------
43 PsiBlast_CBE 85.5840%-140 - C11 -3Q8H ISPF_BURPS C:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
11 PsiBlast_PDB 85.5640%-144 - C11 -3IEQ ISPF_BURP1 A:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
12 PsiBlast_PDB 85.4840%-142 - C11 -3IEW ISPF_BURPS A:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
13 PsiBlast_PDB 85.2840%-144 - C11 -3JVH ISPF_BURP1 A:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
79 PsiBlast_CBE 85.2740%-145 - C11 -3IKF ISPF_BURPS A:[8-161] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
14 PsiBlast_PDB 85.2240%-144 - C11 -3K14 ISPF_BURP1 A:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
10 PsiBlast_PDB 84.9340%-143 - C11 -3F0G ISPF_BURP1 A:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
8 PsiBlast_PDB 84.9040%-141 - C11 -3F0E ISPF_BURP1 A:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
17 PsiBlast_PDB 84.8340%-143 - C11 -3MBM ISPF_BURP1 A:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
82 PsiBlast_CBE 84.8240%-143 - C11 -3IKE ISPF_BURPS A:[8-161] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
40 PsiBlast_CBE 84.6240%-140 - C11 -3QHD ISPF_BURP1 C:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
46 PsiBlast_CBE 84.2440%-142 - C11 -3P10 ISPF_BURP1 B:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
42 PsiBlast_CBE 84.1440%-142 - C11 -3QHD ISPF_BURP1 A:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
65 PsiBlast_CBE 84.1040%-135 - C11 -3F0G ISPF_BURP1 D:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
9 PsiBlast_PDB 83.9840%-139 - C11 -3F0F ISPF_BURP1 A:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
69 PsiBlast_CBE 83.9040%-136 - C11 -3F0F ISPF_BURP1 B:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
15 PsiBlast_PDB 83.7140%-145 - C11 -3K2X ISPF_BURP1 A:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSD----FKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
19 PsiBlast_PDB 83.7040%-143 - C11 -3P10 ISPF_BURP1 A:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
44 PsiBlast_CBE 83.6840%-142 - C11 -3Q8H ISPF_BURPS B:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHF----PRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
18 PsiBlast_PDB 83.2840%-143 - C11 -3P0Z ISPF_BURP1 A:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
115 HHSearch 83.0842%-137 - C11 -5B8F ISPF_PSEAE A:[7-163] ---HMRIGHGYDVHRFGE----GDFITLGGVRIPHKHGLVAHSDGDVLLHALSDALLGAAALGDIGKHFPDTDPRFKGADSRALLRHVVAIVAEKGWKVGNVDATIVAQAPKMAPHIETMRGLIAEDLG---VAVDQ---VNVKATTTERLGFTGR-EEGIAVHAVALLMA--
47 PsiBlast_CBE 83.0140%-145 - C11 -3P0Z ISPF_BURP1 C:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHF------FKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
57 PsiBlast_CBE 82.9740%-144 - C11 -3JVH ISPF_BURP1 C:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHF------FKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
92 PsiBlast_CBE 82.7741%-136 - C11 -2AMT ISPF_ECOLI A:[2-156] -----RIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLG---CHMDD---VNVKATTTEKLGFTGR-GEGIACEAVALLIK--
2 PsiBlast_PDB 82.7441%-139 - C11 -5B8F ISPF_PSEAE A:[9-163] -----RIGHGYDVHRFGE----GDFITLGGVRIPHKHGLVAHSDGDVLLHALSDALLGAAALGDIGKHFPDTDPRFKGADSRALLRHVVAIVAEKGWKVGNVDATIVAQAPKMAPHIETMRGLIAEDLG---VAVDQ---VNVKATTTERLGFTGR-EEGIAVHAVALLMA--
117 HHSearch 82.6137%-138 - C11 -4C8E ISPF_BURCJ A:[22-180] --MDVRIGQGYDVHQLVE----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDAAFKGADSRVLLRACAERVKAAGFTIQNVDSTVIAQAPKLAPHIDGMRANIAADLG---LPLER---VNVKAKTNEKLGYLGR-GEGIEAQAAALLVKQ-
111 HHSearch 82.5337%-131 - C11 -2PMP ISPF_ARATH A:[2-159] --LPFRIGHGFDLHRLEP----GYPLIIGGIVIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAASSVFIKEAVRLMDEAGYEIGNLDATLILQRPKISPHKETIRSNLSKLLG---ADPSV---VNLKAKTHEKVDSLGE-NRSIAAHTVILLMK--
83 PsiBlast_CBE 82.4236%-136 - C11 -2PMP ISPF_ARATH A:[5-159] -----RIGHGFDLHRLEP----GYPLIIGGIVIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAASSVFIKEAVRLMDEAGYEIGNLDATLILQRPKISPHKETIRSNLSKLLG---A---DPSVVNLKAKTHEKVDSLGE-NRSIAAHTVILLMK--
45 PsiBlast_CBE 82.2940%-143 - C11 -3P10 ISPF_BURP1 C:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHF------FKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
94 PsiBlast_CBE 82.1641%-137 - C11 -1U40 ISPF_ECOLI A:[2-155] -----RIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLG---CHMDD---VNVKATTTEKLGFTGR-GEGIACEAVALLI---
23 PsiBlast_CBE 82.1641%-141 - C11 -5B8F ISPF_PSEAE C:[9-163] -----RIGHGYDVHRFGE----GDFITLGGVRIPHKHGLVAHSDGDVLLHALSDALLGAAALGDIGKHFPDTDPRFKGADSRALLRHVVAIVAEKGWKVGNVDATIVAQAPKMAPHIETMRGLIAEDLG---VAVDQ---VNVKATTTERLGFTGR-EEGIAVHAVALLMA--
88 PsiBlast_CBE 82.1441%-135 - C11 -2AMT ISPF_ECOLI E:[2-156] -----RIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLG---CHMDD---VNVKATTTEKLGFTGR-GEGIACEAVALLIK--
90 PsiBlast_CBE 81.9141%-135 - C11 -2AMT ISPF_ECOLI C:[2-156] -----RIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLG---CHMDD---VNVKATTTEKLGFTGR-GEGIACEAVALLIK--
59 PsiBlast_CBE 81.7940%-144 - C11 -3IEW ISPF_BURPS C:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHF----------DSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---
24 PsiBlast_CBE 81.6341%-137 - C11 -5B8F ISPF_PSEAE B:[9-163] -----RIGHGYDVHRFGE----GDFITLGGVRIPHKHGLVAHSDGDVLLHALSDALLGAAALGDIGKHFPDTDPRFKGADSRALLRHVVAIVAEKGWKVGNVDATIVAQAPKMAPHIETMRGLIAEDLG---VAVDQ---VNVKATTTERLGFTGR-EEGIAVHAVALLMA--
93 PsiBlast_CBE 81.6041%-137 - C11 -1U43 ISPF_ECOLI A:[2-155] -----RIGHGFDVHAFGG----EGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLG---CHMDD---VNVKATTTEKLGFTGR-GEGIACEAVALLI---
16 PsiBlast_PDB 81.5940%-145 - C11 -3KE1 ISPF_BURP1 A:[25-178] -----RIGQGYDVHQLVP----GRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHF---------ADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLD---L---PLDRVNVKAKTNEKLGYLGR-GEGIEAQAAALVV---