@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv3602c: (2016-05-21 )
MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYRAILESHWRN

Atome Classification :

(105 SA) .........10........20........30........40........50......-..60........70........80........90........100.......110..--.....---120........130.......140.......150.......160.......170.......180.......190.......200.......210.......220.....---.---.---230.....-....240--........250..-..-...---260.-.------....--..270-........280.......290.......300.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRV-PGSVVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQ---PG-PLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAG---A---Q---A--ALDAA-RAVLDA---APGVAVDYLELRD-IG-LGP---M-PL-N------GSGR--LLVA--ARLGTTRLLDNIAIEIGTFAGTDRPDGYRAILESHWRN
71 PsiBlast_CBE 96.2799%-134 - C7 -1MOP PANC_MYCTU B:[2-288] -AIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRV-PGSVVVVSIFVNPMQFGA---LDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQ---PG-PLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAG---A---Q---A--ALDAA-RAVLDA---APGVAVDYLELRD-IG-LGP---M-PL-N------GSGR--LLVA--ARLGTTRLLDNIAIEIG---------------------
11 PsiBlast_PDB 96.2699%-131 - C7 -4DE5 PANC_MYCTU A:[3-291] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRV-PGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQ---PG-PLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAG---A---Q---A--ALDAA-RAVLDA---APGVAVDYLELRD-IG-LGP---M-PL-N------GSGR--LLVA--ARLGTTRLLDNIAIEIGTFA------------------
40 PsiBlast_CBE 96.2199%-132 - C7 -4MUJ PANC_MYCTO A:[3-290] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRV-PGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQ---PG-PLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAG---A---Q---A--ALDAA-RAVLDA---APGVAVDYLELRD-IG-LGP---M-PL-N------GSGR--LLVA--ARLGTTRLLDNIAIEIGTF-------------------
83 PsiBlast_CBE 96.0299%-130 - C7 -3IMG PANC_MYCTU A:[4-291] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRV-PGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQ---PG-PLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAG---A---Q---A--ALDAA-RAVLDA---APGVAVDYLELRD-IG-LGP---M-PL-N------GSGR--LLVA--ARLGTTRLLDNIAIEIGTF-------------------
6 PsiBlast_PDB 95.8999%-132 - C7 -3IVG PANC_MYCTU A:[3-289] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRV-PGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQ---PG-PLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAG---A---Q---A--ALDAA-RAVLDA---APGVAVDYLELRD-IG-LGP---M-PL-N------GSGR--LLVA--ARLGTTRLLDNIAIEIGT--------------------
4 PsiBlast_PDB 95.8299%-129 - C7 -3IUE PANC_MYCTU A:[3-290] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRV-PGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQ---PG-PLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAG---A---Q---A--ALDAA-RAVLDA---APGVAVDYLELRD-IG-LGP---M-PL-N------GSGR--LLVA--ARLGTTRLLDNIAIEIGTF-------------------
18 PsiBlast_PDB 95.8099%-132 - C7 -1N2I PANC_MYCTU A:[3-288] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRV-PGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQ---PG-PLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAG---A---Q---A--ALDAA-RAVLDA---APGVAVDYLELRD-IG-LGP---M-PL-N------GSGR--LLVA--ARLGTTRLLDNIAIEIG---------------------
67 PsiBlast_CBE 95.7699%-131 - C7 -1N2H PANC_MYCTU B:[2-288] -AIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRV-PGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQ---PG-PLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAG---A---Q---A--ALDAA-RAVLDA---APGVAVDYLELRD-IG-LGP---M-PL-N------GSGR--LLVA--ARLGTTRLLDNIAIEIG---------------------
19 PsiBlast_PDB 95.7599%-128 - C7 -1N2J PANC_MYCTU A:[3-289] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRV-PGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQ---PG-PLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAG---A---Q---A--ALDAA-RAVLDA---APGVAVDYLELRD-IG-LGP---M-PL-N------GSGR--LLVA--ARLGTTRLLDNIAIEIGT--------------------
9 PsiBlast_PDB 95.7599%-129 - C7 -4DDK PANC_MYCTU A:[3-291] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRV-PGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQ---PG-PLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAG---A---Q---A--ALDAA-RAVLDA---APGVAVDYLELRD-IG-LGP---M-PL-N------GSGR--LLVA--ARLGTTRLLDNIAIEIGTFA------------------
7 PsiBlast_PDB 95.7499%-131 - C7 -3IVX PANC_MYCTU A:[3-290] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRV-PGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQ---PG-PLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAG---A---Q---A--ALDAA-RAVLDA---APGVAVDYLELRD-IG-LGP---M-PL-N------GSGR--LLVA--ARLGTTRLLDNIAIEIGTF-------------------
2 PsiBlast_PDB 95.7399%-130 - C7 -4MQ6 PANC_MYCTO A:[3-291] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRV-PGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQ---PG-PLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAG---A---Q---A--ALDAA-RAVLDA---APGVAVDYLELRD-IG-LGP---M-PL-N------GSGR--LLVA--ARLGTTRLLDNIAIEIGTFA------------------
5 PsiBlast_PDB 95.7299%-129 - C7 -3IVC PANC_MYCTU A:[1-298] MAIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRV-PGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQ---PG-PLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAG---A---Q---A--ALDAA-RAVLDA---APGVAVDYLELRD-IG-LGP---M-PL-N------GSGR--LLVA--ARLGTTRLLDNIAIEIGTFAGTDRPDG-----------