@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv3624c: (2016-05-21 )
MTPALVVGPAAWHAVHVTQSSSAITPGQTAELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRELSATTGQDLLLITVLKGAVLFVTDLARAIPVPTQFEFMAVSSYGSSTSSSGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ

Atome Classification :

(71 SA) .........10........20........30........40........50........60.......-.70.-.......80........90..---.---.---....100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTPALVVGPAAWHAVHVTQSSSAITPGQTAELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRELSAT-TGQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSYGSSTSSSGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ
22 PsiBlast_CBE 94.39100%-165 - C4 -4RHY HPRT_MYCTU C:[16-201] ------------------------------ELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRE---T-TGQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSY------SGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ
25 PsiBlast_CBE 93.59100%-160 - C4 -4RHX HPRT_MYCTU C:[15-201] -----------------------------AELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRELSAT-TGQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSS----------VRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVH-NVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ
21 PsiBlast_CBE 93.45100%-163 - C4 -4RHY HPRT_MYCTU D:[17-201] -------------------------------LYPGDIKSVLLTAEQIQARIAELGEQIGNDYR---AT-TGQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSYGS----SGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ
23 PsiBlast_CBE 93.32100%-164 - C4 -4RHY HPRT_MYCTU B:[16-200] ------------------------------ELYPGDIKSVLLTAEQIQARIAELGEQIGNDYR-------GQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSYG------GVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVY-
2 PsiBlast_PDB 93.15100%-158 - C4 -4RHU HPRT_MYCTU A:[13-201] ---------------------------QTAELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRE---T-TGQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSY------SGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ
110 HHSearch 92.76100%-156 - C4 -4RHX HPRT_MYCTU A:[16-200] ------------------------------ELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRELSAT-TGQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSYGS----SGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVY-
3 PsiBlast_PDB 92.76100%-156 - C4 -4RHX HPRT_MYCTU A:[16-200] ------------------------------ELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRELSAT-TGQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSYGS----SGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVY-
31 PsiBlast_CBE 92.19100%-161 - C4 -4RHU HPRT_MYCTU B:[15-201] -----------------------------AELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRELSAT-TGQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSYG-------VVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAV--NVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ
27 PsiBlast_CBE 91.91100%-161 - C4 -4RHU HPRT_MYCTU F:[16-201] ------------------------------ELYPGDIKSVLLTAEQIQARIAELGEQIGNDYR-------GQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSY--------VVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ
30 PsiBlast_CBE 91.71100%-160 - C4 -4RHU HPRT_MYCTU C:[17-198] -------------------------------LYPGDIKSVLLTAEQIQARIAELGEQIGNDYRELSAT-TGQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSYG-------VVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPR---
26 PsiBlast_CBE 91.71100%-161 - C4 -4RHX HPRT_MYCTU B:[15-201] -----------------------------AELYPGDIKSVLLTAEQIQARIAELGEQIGNDYR--SAT-TGQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSS----------VRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ
4 PsiBlast_PDB 90.88100%-160 - C4 -4RHY HPRT_MYCTU A:[16-200] ------------------------------ELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRE------GQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSY--------VVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVY-
24 PsiBlast_CBE 90.80100%-154 - C4 -4RHX HPRT_MYCTU D:[17-200] -------------------------------LYPGDIKSVLLTAEQIQARIAELGEQIGNDYRELSAT-TGQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSS----------VRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVY-
34 PsiBlast_CBE 89.88100%-168 - C4 -4RHT HPRT_MYCTU B:[20-199] ----------------------------------GDIKSVLLTAEQIQARIAELGEQIGNDYRE-------QD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSY--------VVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRV--
28 PsiBlast_CBE 89.30100%-163 - C4 -4RHU HPRT_MYCTU E:[16-201] ------------------------------ELYPGDIKSVLLTAEQIQARIAELGEQIGNDYR------TGQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSS------------ILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ
1 PsiBlast_PDB 89.29100%-168 - C4 -4RHT HPRT_MYCTU A:[21-198] -----------------------------------DIKSVLLTAEQIQARIAELGEQIGNDYR-------GQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSYG------GVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPR---
29 PsiBlast_CBE 88.32100%-160 - C4 -4RHU HPRT_MYCTU D:[20-198] ----------------------------------GDIKSVLLTAEQIQARIAELGEQIGNDYRE--AT-TGQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSY---------VRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPR---
32 PsiBlast_CBE 86.99100%-167 - C4 -4RHT HPRT_MYCTU D:[21-197] -----------------------------------DIKSVLLTAEQIQARIAELGEQIGNDY---------QD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSYGS----SGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPD---ANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDP----
33 PsiBlast_CBE 85.45100%-160 - C4 -4RHT HPRT_MYCTU C:[23-195] -------------------------------------KSVLLTAEQIQARIAELGEQIGNDYR----T-TGQD-LLLITVLKGAVLFVTDLARAI---P---V---PTQFEFMAVSSYG-------VVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAV-ANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTL------
128 HHSearch 83.2956%-161 - C4 -1YFZ ? A:[28-204] --------------------------------PMEDIEEILITEEQLKAKVKELGEMITRDYEG-------KD-LVLIGVLKGAIMFMSGLSRAI---D---L---PLSIDFLAVSSYGSSTKSSGIVKIIKDHDIDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIGVLKPELY-
6 PsiBlast_PDB 82.9555%-164 - C4 -1YFZ ? A:[31-204] -----------------------------------DIEEILITEEQLKAKVKELGEMITRDYE-------GKD-LVLIGVLKGAIMFMSGLSRAI---D---L---PLSIDFLAVSSYGSSTKSSGIVKIIKDHDIDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIGVLKPELY-
35 PsiBlast_CBE 81.2555%-160 - C4 -1YFZ ? B:[31-204] -----------------------------------DIEEILITEEQLKAKVKELGEMITRDYE-------GKD-LVLIGVLKGAIMFMSGLSRAI---D---L---PLSIDFLAVSSYGSSTKSSGIVKIIKDHDIDIEGKDVLIVEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVDYCGFKIPDKFVVGYGLDYAEKYRNLPFIGVLKPELY-
9 PsiBlast_PDB 78.0648%-155 - C4 -3H83 ? A:[21-202] ---------------------------QSNAMMNQDIEKVLISEEQIQEKVLELGAIIAEDYKNTVP--------LAIGVLKGAMPFMADLLKRT---D---T---YLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVY-
114 HHSearch 77.3249%-146 - C4 -3HVU ? A:[19-202] ------------------------YFQS-NAMMNQDIEKVLISEEQIQEKVLELGAIIAEDYKN-------TV-PLAIGVLKGAMPFMADLLKRT---D---T---YLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVY-
11 PsiBlast_PDB 77.1048%-157 - C4 -3KB8 ? A:[21-202] ---------------------------QSNAMMNQDIEKVLISEEQIQEKVLELGAIIAEDYKNTVP--------LAIGVLKGAMPFMADLLKRT---D---T---YLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVY-
42 PsiBlast_CBE 77.0648%-146 - C4 -3HVU ? C:[21-202] ---------------------------QSNAMMNQDIEKVLISEEQIQEKVLELGAIIAEDYKNTVP--------LAIGVLKGAMPFMADLLKRT---D---T---YLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVY-
43 PsiBlast_CBE 76.9848%-149 - C4 -3HVU ? B:[21-202] ---------------------------QSNAMMNQDIEKVLISEEQIQEKVLELGAIIAEDYKNTVP--------LAIGVLKGAMPFMADLLKRT---D---T---YLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVY-
10 PsiBlast_PDB 76.8448%-149 - C4 -3HVU ? A:[21-202] ---------------------------QSNAMMNQDIEKVLISEEQIQEKVLELGAIIAEDYKNTVP--------LAIGVLKGAMPFMADLLKRT---D---T---YLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVY-
41 PsiBlast_CBE 76.8048%-150 - C4 -3HVU ? D:[21-202] ---------------------------QSNAMMNQDIEKVLISEEQIQEKVLELGAIIAEDYKNTVP--------LAIGVLKGAMPFMADLLKRT---D---T---YLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVY-
72 PsiBlast_CBE 76.5943%-160 - C4 -1I14 ? B:[9-190] -------------------------------------EKILFTEEEIRTRIKEVAKRIADDYKGKGLR-PYVNPLVLISVLKGSFMFTADLCRAL---CDFNV---PVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVETALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY-
58 PsiBlast_CBE 76.4744%-156 - C4 -1TC2 ? B:[9-190] -------------------------------------EKILFTEEEIRTRIKEVAKRIADDYKGKGLR-PYVNPLVLISVLKGSFMFTADLCRAL---CDFNV---PVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY-
64 PsiBlast_CBE 76.1444%-151 - C4 -1TC1 ? B:[8-189] -------------------------------------EKILFTEEEIRTRIKEVAKRIADDYKGKGLR-PYVNPLVLISVLKGSFMFTADLCRALCDFN---V---PVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY-
61 PsiBlast_CBE 76.0744%-158 - C4 -1P19 ? C:[9-190] -------------------------------------EKILFTEEEIRTRIKEVAKRIADDYKGKGLR-PYVNPLVLISVLKGSFMFTADLCRAL---CDFNV---PVRMEFICVSSYGE----SGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY-
40 PsiBlast_CBE 76.0048%-157 - C4 -3KB8 ? B:[21-202] ---------------------------QSNAMMNQDIEKVLISEEQIQEKVLELGAIIAEDYKNTVP--------LAIGVLKGAMPFMADLLKRT---D---T---YLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVY-
78 PsiBlast_CBE 75.9343%-156 - C4 -1I13 ? B:[9-190] -------------------------------------EKILFTEEEIRTRIKEVAKRIADDYKGKGLR-PYVNPLVLISVLKGSFMFTADLCRAL---CDFNV---PVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVATALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY-
46 PsiBlast_CBE 75.5748%-150 - C4 -3H83 ? B:[21-202] ---------------------------QSNAMMNQDIEKVLISEEQIQEKVLELGAIIAEDYKNTVP--------LAIGVLKGAMPFMADLLKRT---D---T---YLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVY-
69 PsiBlast_CBE 75.2843%-154 - C4 -1P17 ? C:[9-190] -------------------------------------EKILFTEEEIRTRIKEVAKRIADDYKGKGLR-PYVNPLVLISVLRGSFMFTADLCRAL---CDFNV---PVRMEFICVSSYGE---SSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY-
63 PsiBlast_CBE 75.0744%-151 - C4 -1P19 ? A:[9-190] -------------------------------------EKILFTEEEIRTRIKEVAKRIADDYKGKGLR-PYVNPLVLISVLKGSFMFTADLCRAL---CDFNV---PVRMEFICVSSY--GLTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY-
76 PsiBlast_CBE 74.9943%-156 - C4 -1I0I ? B:[9-190] -------------------------------------EKILFTEEEIRTRIKEVAKRIADDYKGKGLR-PYVNPLVLISVLKGSFMFTADLCRAL---CDFNV---PVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVQTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY-
71 PsiBlast_CBE 74.7643%-152 - C4 -1P17 ? A:[9-190] -------------------------------------EKILFTEEEIRTRIKEVAKRIADDYKGKGLR-PYVNPLVLISVLRGSFMFTADLCRAL---CDFNV---PVRMEFICVSSYG---TSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY-
66 PsiBlast_CBE 74.7443%-151 - C4 -1P18 ? B:[9-190] -------------------------------------EKILFTEEEIRTRIKEVAKRIADDYKGKGLR-PYVNPLVLISVLRGSFMFTADLCRAL---CDFNV---PVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY-
59 PsiBlast_CBE 74.6544%-153 - C4 -1TC2 ? A:[9-190] -------------------------------------EKILFTEEEIRTRIKEVAKRIADDYKGKGLR-PYVNPLVLISVLKGSFMFTADLCRAL---CDFNV---PVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY-
74 PsiBlast_CBE 74.5843%-154 - C4 -1I0L ? B:[9-190] -------------------------------------EKILFTEEEIRTRIKEVAKRIADDYKGKGLR-PYVNPLVLISVLKGSFMFTADLCRALCDFN---V---PVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVNTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY-