@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Rv3913: (2016-05-24 )
MTAPPVHDRAHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTDVENYPGFRNGITGPELMDEMREQALRFGADLRMEDVESVSLHGPLKSVVTADGQTHRARAVILAMGAAARYLQVPGEQELLGRGVSSCATCDGFFFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLPVTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTYRQAVTAAGSGCAAAIDAERWLAEHAATGEADSTDALIGAQR

Atome Classification :

(49 SA) .........10.....-...20........30........40....-----.-----.-----..50..-----......60........70........80......---..90.....---.-------..100----..--....---..110.......120.......130....----...----140.......150.--........160.......170.......180.......190...---....200---.......210...---...-.220--..----.-......230.-.......240.......250......-.260.......270----..----.....280.......290.--......300.......310.....-..320.......330...
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTAPPVHDRAHHPVRD-VIVIGSGPAGYTAALYAARAQLAPLVFEG-----T-----S-----FGGALM-----TTTDVENYPGFRNGITGPELMDEMREQALRFGAD---LRMEDVESV---S-------LHG-P----LK--SVVT---ADGQTHRARAVILAMGAAARYLQVPGEQE----LLG----RGVSSCATCDG--F--FFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKI---MLDRARN---NDKIRFLTNHTVV---AVD-GD----TT----V-TGLRVRDT-N-TGAETTLPVTGVFVAIGHEPRSGLVR-EAIDVDPDGYVLVQ----GR----TTSTSLPGVFAAGDLVDRT--YRQAVTAAGSGCAAAIDAERWLAE-HAATGEADSTDALIGAQR
71 HHSearch 97.01100%-119 - C1 -2A87 TRXB_MYCTU A:[10-322] ---------AHHPVRD-VIVIGSGPAGYTAALYAARAQLAPLVFEG-----T-----S-----FGGALM-----TTTDVENYPGFRNGITGPELMDEMREQALRFGAD---LRMEDVESV---S-------LHG-P----LK--SVVT---ADGQTHRARAVILAMGAAARYLQVPGEQE----LLG----RGVSSCATCDG--F--FFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKI---MLDRARN---NDKIRFLTNHTVV---AVD-GD----TT----V-TGLRVRDT-N-TGAETTLPVTGVFVAIGHEPRSGLVR-EAIDVDPDGYVLVQ----GR----TTSTSLPGVFAAGDLVDRT--YRQAVTAAGSGCAAAIDAERWLAE-HAATG-------------
1 PsiBlast_PDB 97.01100%-119 - C1 -2A87 TRXB_MYCTU A:[10-322] ---------AHHPVRD-VIVIGSGPAGYTAALYAARAQLAPLVFEG-----T-----S-----FGGALM-----TTTDVENYPGFRNGITGPELMDEMREQALRFGAD---LRMEDVESV---S-------LHG-P----LK--SVVT---ADGQTHRARAVILAMGAAARYLQVPGEQE----LLG----RGVSSCATCDG--F--FFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKI---MLDRARN---NDKIRFLTNHTVV---AVD-GD----TT----V-TGLRVRDT-N-TGAETTLPVTGVFVAIGHEPRSGLVR-EAIDVDPDGYVLVQ----GR----TTSTSLPGVFAAGDLVDRT--YRQAVTAAGSGCAAAIDAERWLAE-HAATG-------------
21 PsiBlast_CBE 94.66100%-118 - C1 -2A87 TRXB_MYCTU B:[15-318] --------------RD-VIVIGSGPAGYTAALYAARAQLAPLVFEG-----T-----S-----FGGALM-----TTTDVENYPGFRNGITGPELMDEMREQALRFGAD---LRMEDVESV---S-------LHG-P----LK--SVVT---ADGQTHRARAVILAMGAAARYLQVPGEQE----LLG----RGVSSCATCDG--F--FFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKI---MLDRARN---NDKIRFLTNHTVV---AVD-GD----TT----V-TGLRVRDT-N-TGAETTLPVTGVFVAIGHEPRSGLVR-EAIDVDPDGYVLVQ----GR----TTSTSLPGVFAAGDLVDRT--YRQAVTAAGSGCAAAIDAERWLAE-H-----------------
9 PsiBlast_PDB 83.7450%-112 - C1 -1VDC TRXB1_ARATH A:[7-324] -----------HNTR--LCIVGSGPAAHTAAIYAARAELKPLLFEGWMANDI-----A-----PGGQLT-----TTTDVENFPGFPEGILGVELTDKFRKQSERFGTT---IFTETVTKV---D-------FSSKP----FK----LF---TDSKAILADAVILAIGAVAKRLSFVGSGE----VLGGFWNRGISACAVCDG--AAPIFRNKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDAFRASKI---MQQRALS---NPKIDVIWNSSVV---EAY-GDGER-DV----L-GGLKVKNV-V-TGDVSDLKVSGLFFAIGHEPATKFLD-GGVELDSDGYVVTK----PG----TTQTSVPGVFAAGDVQDKK--YRQAITAAGTGCMAALDAEHYLQE-------------------
38 PsiBlast_CBE 82.8448%-117 - C1 -2WHD ? B:[28-343] ------------PLRTRVCIIGSGPAAHTAAIYAARAELKPVLFEGWMANDI-----A-----AGGQLT-----TTTDVENFPGFPTGIMGIDLMDNCRAQSVRFGTN---ILSETVTEV---D-------FSARP----FR----VT---SDSTTVLADTVVVATGAVARRLYFSGSDT----YWN----RGISACAVCDG--AAPIFRNKPIAVIGGGDSAMEEGNFLTKYGSQVYIIHRRNTFRASKI---MQARALS---NPKIQVVWDSEVVEAYGGA-GG----GP----L-AGVKVKNL-V-TGEVSDLQVSGLFFAIGHEPATKFLN-GQLELHADGYVATK----PG----STHTSVEGVFAAGDVQDKK--YRQAITAAGSGCMAALDAEHYLQEV------------------
80 HHSearch 82.6351%-105 - C1 -1VDC TRXB1_ARATH A:[5-325] ----------ETHNTR-LCIVGSGPAAHTAAIYAARAELKPLLFEG-----WMANDIA-----PGGQLT-----TTTDVENFPGFPEGILGVELTDKFRKQSERFGTT---IFTETVTKV---D-------FSS-K----PF--KLFT----DSKAILADAVILAIGAVAKRLSFVGSGEVLGGFWN----RGISACAVCDGAAP--IFRNKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDAFRASKI---MQQRALS---NPKIDVIWNSSVV---EAY-GD----GERDV-L-GGLKVKNV-V-TGDVSDLKVSGLFFAIGHEPATKFLD-GGVELDSDGYVVTK----PG----TTQTSVPGVFAAGDVQDKK--YRQAITAAGTGCMAALDAEHYLQE-I-----------------
23 PsiBlast_CBE 82.5446%-109 - C1 -3ITJ TRXB1_YEAST C:[19-334] ----------SHVHNK-VTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGI-----A-----AGGQLT-----TTTEIENFPGFPDGLTGSELMDRMREQSTKFGTE---IITETVSKV---D-------LSSKP----FKLWTEFN---EDAEPVTTDAIILATGASAKRMHLPGEET----YWQ----KGISACAVCDG--AV--FRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRAST------KRAEK---NEKIEILYNTVAL---EAK-GDG---KL----L-NALRIKNT-K-KNEETDLPVSGLFYAIGHTPATKIVA-GQVDTDEAGYIKTV----PG----SSLTSVPGFFAAGDVQDSK--YRQAITSAGSGCMAALDAEKYL---------------------
18 PsiBlast_PDB 82.1548%-116 - C1 -2WHD ? A:[28-343] ------------PLRTRVCIIGSGPAAHTAAIYAARAELKPVLFEGWMANDI-----A-----AGGQLT-----TTTDVENFPGFPTGIMGIDLMDNCRAQSVRFGTN---ILSETVTEV---D-------FSARP----FR----VT---SDSTTVLADTVVVATGAVARRLYFSGSDT----YWN----RGISACAVCDG--AAPIFRNKPIAVIGGGDSAMEEGNFLTKYGSQVYIIHRRNTFRASKI---MQARALS---NPKIQVVWDSEVVEAYGGA-GG----GP----L-AGVKVKNL-V-TGEVSDLQVSGLFFAIGHEPATKFLN-GQLELHADGYVATK----PG----STHTSVEGVFAAGDVQDKK--YRQAITAAGSGCMAALDAEHYLQEV------------------
8 PsiBlast_PDB 81.8346%-111 - C1 -3D8X TRXB1_YEAST A:[11-322] --------------NK-VTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGI-----A-----AGGQLT-----TTTEIENFPGFPDGLTGSELMDRMREQSTKFGTE---IITETVSKV---D-------LSSKP----FKLWTEFN---EDAEPVTTDAIILATGASAKRMHLPGEET----YWQ----KGISACAVCDG--AVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTI---MQKRAEK---NEKIEILYNTVAL---EAK-GDG---KL----L-NALRIKNT-K-KNEETDLPVSGLFYAIGHTPATKIVA-GQVDTDEAGYIKTV----PG----SSLTSVPGFFAAGDVQDSK--YRQAITSAGSGCMAALDAEKYL---------------------
72 HHSearch 81.4646%-110 - C1 -4JNQ ? A:[21-338] --------SMTQRHAP-VIVIGSGPAGYTAAIYAARAMLKPVVIAG-----L-----Q-----QGGQLM-----ITTDVENYPGYAEPVQGPWMMEQMARQAENVGAQ---IVHDIITEV---E-------TTV-R----PF--RLKG---DSGTIYTCDALIIATGAQAKWLGLESEQT----FMG----GGVSACATCDG--F--FYRGKDVVVVGGGNTAVEEALYLSHIAKSVTIVHRRDGFRAEKI---MQDRLLS---RENVSVVWNSVID---EIL-GT----EARGATV-TGVRLKNI-V-TGETQERATHGVFIAIGHAPAVSLFE-GKLKQKPNGYLWTA----PD----STATDVPGIFAAGDVTDDI--YRQAVTAAGMGCMAALEAERWLAA-QE----------------
28 PsiBlast_CBE 81.3846%-110 - C1 -3D8X TRXB1_YEAST B:[11-322] --------------NK-VTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGI-----A-----AGGQLT-----TTTEIENFPGFPDGLTGSELMDRMREQSTKFGTE---IITETVSKV---D-------LSSKP----FKLWTEFN---EDAEPVTTDAIILATGASAKRMHLPGEET----YWQ----KGISACAVCDG--AVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTI---MQKRAEK---NEKIEILYNTVAL---EAK-GDG---KL----L-NALRIKNT-K-KNEETDLPVSGLFYAIGHTPATKIVA-GQVDTDEAGYIKTV----PG----SSLTSVPGFFAAGDVQDSK--YRQAITSAGSGCMAALDAEKYL---------------------
15 PsiBlast_PDB 81.3546%-118 - C1 -4JNQ ? A:[26-338] ----------HAPV----IVIGSGPAGYTAAIYAARAMLKPVVIAG-----L-----Q-----QGGQLM-----ITTDVENYPGYAEPVQGPWMMEQMARQAENVGAQ---IVHDIITEV---ETTVRPFRLKG-D----SG--TIYT---CD-------ALIIATGAQAKWLGLESEQT----FMG----GGVSACATCDG--F--FYRGKDVVVVGGGNTAVEEALYLSHIAKSVTIVHRRDGFRAEKI---MQDRLLS---RENVSVVWNSVID---EIL-GTEARGAT----V-TGVRLKNI-V-TGETQERATHGVFIAIGHAPAVSLFE-GKLKQKPNGYLWTA----PD----STATDVPGIFAAGDVTDDI--YRQAVTAAGMGCMAALEAERWLAA-QE----------------
5 PsiBlast_PDB 81.2048%-117 - C1 -1TDF TRXB_ECOLI A:[8-313] -----------------LLILGSGPAGYTAAVYAARANLQPVLITG-----M-----E-----KGGQLT-----TTTEVENWPGDPNDLTGPLLMERMHEHATKFETE---IIFDHINKV---D-------LQNRP----FR----LN---GDNGEYTCDALIIATGASARYLGLPSEEA----FKG----RGVSACATSDG--F--FYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKI---LIKRLMDKVENGNIILHTNRTLE---EVT-GD----QMG---V-TGVRLRDTQN-SDNIESLDVAGLFVAIGHSPNTAIFE-GQLELE-NGYIKVQSGIHGN----ATQTSIPGVFAAGDVMDHI--YRQAITSAGTGCMAALDAERYL---------------------
24 PsiBlast_CBE 81.1446%-105 - C1 -3ITJ TRXB1_YEAST B:[20-334] -----------HVHNK-VTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGI-----A-----AGGQLT-----TTTEIENFPGFPDGLTGSELMDRMREQSTKFGTE---IITETVSKV---D-------LSSKP----FKLWTEFN---EDAEPVTTDAIILATGASAKRMHLPGEET----YWQ----KGISACAVCDG--AVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTI---MQKRAEK---NEKIEILYNTVAL---EAK-GDG---KL----L-NALRIKNT-K-KNEETDLPVSGLFYAIGHTPATKIVA-GQVDTDEAGYIKTV----PG----SSLTSVPGFFAAGDVQDSK--YRQAITSAGSGCMAALDAEKYL---------------------
4 PsiBlast_PDB 81.0046%-103 - C1 -3ITJ TRXB1_YEAST A:[21-334] ------------VHNK-VTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGI-----A-----AGGQLT-----TTTEIENFPGFPDGLTGSELMDRMREQSTKFGTE---IITETVSKV---D-------LSSKP----FKLWTEFN---EDAEPVTTDAIILATGASAKRMHLPGEET----YWQ----KGISACAVCDG--AVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTI---MQKRAEK---NEKIEILYNTVAL---EAK-GDG---KL----L-NALRIKNT-K-KNEETDLPVSGLFYAIGHTPATKIVA-GQVDTDEAGYIKTV----PG----SSLTSVPGFFAAGDVQDSK--YRQAITSAGSGCMAALDAEKYL---------------------
73 HHSearch 80.9347%-103 * C1 *3ITJ TRXB1_YEAST A:[21-336] ------------VHNK-VTIIGSGPAAHTAAIYLARAEIKPILYEG-----M-----MANGIAAGGQLT-----TTTEIENFPGFPDGLTGSELMDRMREQSTKFGTE---IITETVSKV---D-------LSS-K----PF--KLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEET----YWQ----KGISACAVCDG--AVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTI---MQKRAEK---NEKIEILYNTVAL---EAK-GD----GK----LLNALRIKNT-K-KNEETDLPVSGLFYAIGHTPATKIVA-GQVDTDEAGYIKTV----PG----SSLTSVPGFFAAGDVQDSK--YRQAITSAGSGCMAALDAEKYLTS-------------------
3 PsiBlast_PDB 80.9149%-118 - C1 -1CL0 TRXB_ECOLI A:[8-313] -----------------LLILGSGPAGYTAAVYAARANLQPVLITG-----M-----E-----KGGQLT-----TTTEVENWPGDPNDLTGPLLMERMHEHATKFETE---IIFDHINKV---D-------LQNRP----FR----LN---GDNGEYTCDALIIATGASARYLGLPSEEA----FKG----RGVSACATCDG--F--FYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKI---LIKRLMDKVENGNIILHTNRTLE---EVT-GD----QMG---V-TGVRLRDTQN-SDNIESLDVAGLFVAIGHSPNTAIFE-GQLELE-NGYIKVQSGIHGN----ATQTSIPGVFAAGDVMDHI--YRQAITSAGTGCMAALDAERYL---------------------
2 PsiBlast_PDB 80.8549%-115 - C1 -1TDE TRXB_ECOLI A:[8-313] -----------------LLILGSGPAGYTAAVYAARANLQPVLITG-----M-----E-----KGGQLT-----TTTEVENWPGDPNDLTGPLLMERMHEHATKFETE---IIFDHINKV---D-------LQNRP----FR----LN---GDNGEYTCDALIIATGASARYLGLPSEEA----FKG----RGVSACATCDG--F--FYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKI---LIKRLMDKVENGNIILHTNRTLE---EVT-GD----QMG---V-TGVRLRDTQN-SDNIESLDVAGLFVAIGHSPNTAIFE-GQLELE-NGYIKVQSGIHGN----ATQTSIPGVFAAGDVMDHI--YRQAITSAGTGCMAALDAERYL---------------------
31 PsiBlast_CBE 80.7943%-106 - C1 -4CCR ? B:[4-314] -------------IHD-VVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGV-----A-----AGGQLT-----TTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTT---IITETIDHV---D-------FST-Q----PF--KLFT---EEGKEVLTKSVIIATGATAKRMHVPGEDK----YWQ----NGVSACAICDG--AVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKT---MQERVLN---HPKIEVIWNSELV---ELE-GDG---DL----L-NGAKIHNL-V-SGEYKVVPVAGLFYAIGHSPNSKFLG-GQVKTADDGYILTE----G------PKTSVDGVFACGDVCDRV--YRQAIVAAGSGCMAALSCEKWLQT-H-----------------
34 PsiBlast_CBE 80.6743%-108 - C1 -4A65 ? B:[4-314] -------------IHD-VVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGV-----A-----AGGQLT-----TTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTT---IITETIDHV---D-------FST-Q----PF--KLFT---EEGKEVLTKSVIIATGATAKRMHVPGEDK----YWQ----NGVSACAICDG--AVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKT---MQERVLN---HPKIEVIWNSELV---ELE-GDG---DL----L-NGAKIHNL-V-SGEYKVVPVAGLFYAIGHSPNSKFLG-GQVKTADDGYILTE----G------PKTSVDGVFACGDVCDRV--YRQAIVAAGSGCMAALSCEKWLQT-H-----------------
37 PsiBlast_CBE 80.5343%-107 - C1 -4UP3 ? B:[4-314] -------------IHD-VVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGV-----A-----AGGQLT-----TTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTT---IITETIDHV---D-------FST-Q----PF--KLFT---EEGKEVLTKSVIIATGATAKRMHVPGEDK----YWQ----NGVSASAICDG--AVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKT---MQERVLN---HPKIEVIWNSELV---ELE-GDG---DL----L-NGAKIHNL-V-SGEYKVVPVAGLFYAIGHSPNSKFLG-GQVKTADDGYILTE----G------PKTSVDGVFACGDVQDRV--YRQAIVAAGSGCMAALSCEKWLQT-H-----------------
14 PsiBlast_PDB 80.4643%-109 - C1 -4CCR ? A:[4-314] -------------IHD-VVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGV-----A-----AGGQLT-----TTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTT---IITETIDHV---D-------FST-Q----PF--KLFT---EEGKEVLTKSVIIATGATAKRMHVPGEDK----YWQ----NGVSACAICDG--AVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFR--KT---MQERVLN---HPKIEVIWNSELV---ELE-GDG---DL----L-NGAKIHNL-V-SGEYKVVPVAGLFYAIGHSPNSKFLG-GQVKTADDGYILTE----G------PKTSVDGVFACGDVCDRV--YRQAIVAAGSGCMAALSCEKWLQT-H-----------------
16 PsiBlast_PDB 80.4244%-106 - C1 -2Q7V ? A:[2-314] -TAPTAHDY------D-VVIIGGGPAGLTAAIYTGRAQLSTLILEK-----G-----M-----PGGQIA-----WSEEVENFPGFPEPIAGMELAQRMHQQAEKFGAK---VEMDEVQGVQHDA-------TSH-P----YP--FTVR---GYNGEYRAKAVILATGADPRKLGIPGEDN----FWG----KGVSTCATCDG--F--FYKGKKVVVIGGGDAAVEEGMFLTKFADEVTVIHRRDTLRANKV---AQARAFA---NPKMKFIWDTAVE---EIQ-GA----DS----V-SGVKLRNL-K-TGEVSELATDGVFIFIGHVPNTAFVK-DTVSLRDDGYVDVR----DE-----IYTNIPMLFAAGDVSDYI--YRQLATSVGAGTRAAMMTERQLAA-L-----------------
36 PsiBlast_CBE 80.3044%-109 - C1 -2Q7V ? B:[6-314] -----AHDY------D-VVIIGGGPAGLTAAIYTGRAQLSTLILEK-----G-----M-----PGGQIA-----WSEEVENFPGFPEPIAGMELAQRMHQQAEKFGAK---VEMDEVQGVQHDA-------TSH-P----YP--FTVR---GYNGEYRAKAVILATGADPRKLGIPGEDN----FWG----KGVSTCATCDG--F--FYKGKKVVVIGGGDAAVEEGMFLTKFADEVTVIHRRDTLRANKV---AQARAFA---NPKMKFIWDTAVE---EIQ-GA----DS----V-SGVKLRNL-K-TGEVSELATDGVFIFIGHVPNTAFVK-DTVSLRDDGYVDVR----DE-----IYTNIPMLFAAGDVSDYI--YRQLATSVGAGTRAAMMTERQLAA-L-----------------
78 HHSearch 80.2844%-111 - C1 -2Q7V ? A:[6-314] -----------AHDYD-VVIIGGGPAGLTAAIYTGRAQLSTLILEK-----G-----M-----PGGQIA-----WSEEVENFPGFPEPIAGMELAQRMHQQAEKFGAK---VEMDEVQGV---Q-------HDA-TSHPYPF--TVRG----YNGEYRAKAVILATGADPRKLGIPGEDN----FWG----KGVSTCATCDG--F--FYKGKKVVVIGGGDAAVEEGMFLTKFADEVTVIHRRDTLRANKV---AQARAFA---NPKMKFIWDTAVE---EIQ-GA----DS----V-SGVKLRNL-K-TGEVSELATDGVFIFIGHVPNTAFVK-DTVSLRDDGYVDVR----D-----EIYTNIPMLFAAGDVSDYI--YRQLATSVGAGTRAAMMTERQLAA-L-----------------
7 PsiBlast_PDB 80.1148%-116 - C1 -1TRB TRXB_ECOLI A:[8-313] -----------------LLILGSGPAGYTAAVYAARANLQPVLITG-----M-----E-----KGGQLT-----TTTEVENWPGDPNDLTGPLLMERMHEHATKFETE---IIFDHINKV---D-------LQNRP----FR----LN---GDNGEYTCDALIIATGASARYLGLPSEEA----FKG----RGVSACATSDG--F--FYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKI---LIKRLMDKVENGNIILHTNRTLE---EVT-GD----QMG---V-TGVRLRDTQN-SDNIESLDVAGLFVAIGHSPNTAIFE-GQLELE-NGYIKVQSGIHGN----ATQTSIPGVFAAGDVMDHI--YRQAITSAGTGCMAALDAERYL---------------------
30 PsiBlast_CBE 80.0843%-106 - C1 -4CCR ? C:[4-314] -------------IHD-VVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGV-----A-----AGGQLT-----TTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTT---IITETIDHV---D-------FST-Q----PF--KLFT---EEGKEVLTKSVIIATGATAKRMHVPGEDK----YWQ----NGVSACAICDG--AVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKT---MQERVLN---HPKIEVIWNSELV---ELE-GDG---DL----L-NGAKIHNL-V-SGEYKVVPVAGLFYAIGHSPNSKFLG-GQVKTADDGYILTE----G------PKTSVDGVFACGDVCDRV--YRQAIVAAGSGCMAALSCEKWLQT-H-----------------
12 PsiBlast_PDB 80.0343%-110 - C1 -4CBQ ? A:[4-314] -------------IHD-VVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGV-----A-----AGGQLT-----TTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTT---IITETIDHV---D-------FST-Q----PF--KLFT---EEGKEVLTKSVIIATGATAKRMHVPGEDK----YWQ----NGVSACAICDG--AVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKT---MQERVLN---HPKIEVIWNSELV---ELE-GDG---DL----L-NGAKIHNL-V-SGEYKVVPVAGLFYAIGHSPNSKFLG-GQVKTADDGYILTE----G------PKTSVDGVFACGDVCDRV--YRQAIVAAGSGCMAALSCEKWLQT-H-----------------