@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA0038: (2015-12-19 )
MSNHHTYKKIELVGSSKTSIEDAINNALAEAAKSIQHLEWFEVVDTRGHIENGAVGHYQVTLKVGFRIANS

Atome Classification :

(24 SA) .........10........20........30........40........50........60........70
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSNHHTYKKIELVGSSKTSIEDAINNALAEAAKSIQHLEWFEVVDTRGHIENGAVGHYQVTLKVGFRIANS
37 PsiBlast_CBE 96.5453%-109 - C15 -3OQT ? H:[1-70] MSNH-TYRVIEIVGTSPDGVDAAIQGGLARAAQTMRALDWFEVQSIRGHLVDGAVAHFQVTMKVGFRLEDS
36 PsiBlast_CBE 95.9553%-108 - C15 -3OQT ? I:[1-70] MSNH-TYRVIEIVGTSPDGVDAAIQGGLARAAQTMRALDWFEVQSIRGHLVDGAVAHFQVTMKVGFRLEDS
2 PsiBlast_PDB 95.1553%-109 - C15 -3OQT ? A:[1-70] MSNH-TYRVIEIVGTSPDGVDAAIQGGLARAAQTMRALDWFEVQSIRGHLVDGAVAHFQVTMKVGFRLEDS
32 PsiBlast_CBE 95.0353%-118 - C15 -3OQT ? P:[1-70] MSNH-TYRVIEIVGTSPDGVDAAIQGGLARAAQTMRALDWFEVQSIRGHLVDGAVAHFQVTMKVGFRLEDS
38 PsiBlast_CBE 94.5153%-109 - C15 -3OQT ? E:[1-70] MSNH-TYRVIEIVGTSPDGVDAAIQGGLARAAQTMRALDWFEVQSIRGHLVDGAVAHFQVTMKVGFRLEDS
27 PsiBlast_CBE 94.5062%-115 - C15 -2VXA DODEC_HALHL F:[4-67] ----HVYKIVELTGSSPNGIEEAVNNAIARAGETLRHLRWFEVVDTRGHIEGGRVNHWQVTVKVGFTLEG-
21 PsiBlast_CBE 93.9162%-108 - C15 -2VXA DODEC_HALHL L:[4-67] ----HVYKIVELTGSSPNGIEEAVNNAIARAGETLRHLRWFEVVDTRGHIEGGRVNHWQVTVKVGFTLEG-
35 PsiBlast_CBE 93.8353%-106 - C15 -3OQT ? K:[1-70] MSNH-TYRVIEIVGTSPDGVDAAIQGGLARAAQTMRALDWFEVQSIRGHLVDGAVAHFQVTMKVGFRLEDS
25 PsiBlast_CBE 93.6062%-110 - C15 -2VXA DODEC_HALHL H:[4-67] ----HVYKIVELTGSSPNGIEEAVNNAIARAGETLRHLRWFEVVDTRGHIEGGRVNHWQVTVKVGFTLEG-
31 PsiBlast_CBE 93.5462%-109 - C15 -2VXA DODEC_HALHL B:[4-67] ----HVYKIVELTGSSPNGIEEAVNNAIARAGETLRHLRWFEVVDTRGHIEGGRVNHWQVTVKVGFTLEG-
1 PsiBlast_PDB 93.4262%-110 - C15 -2VXA DODEC_HALHL A:[4-67] ----HVYKIVELTGSSPNGIEEAVNNAIARAGETLRHLRWFEVVDTRGHIEGGRVNHWQVTVKVGFTLEG-
39 PsiBlast_CBE 93.0953%-105 - C15 -3OQT ? C:[1-70] MSNH-TYRVIEIVGTSPDGVDAAIQGGLARAAQTMRALDWFEVQSIRGHLVDGAVAHFQVTMKVGFRLEDS
29 PsiBlast_CBE 92.9362%-110 - C15 -2VXA DODEC_HALHL D:[4-67] ----HVYKIVELTGSSPNGIEEAVNNAIARAGETLRHLRWFEVVDTRGHIEGGRVNHWQVTVKVGFTLEG-
26 PsiBlast_CBE 92.6562%-110 - C15 -2VXA DODEC_HALHL G:[4-67] ----HVYKIVELTGSSPNGIEEAVNNAIARAGETLRHLRWFEVVDTRGHIEGGRVNHWQVTVKVGFTLEG-
24 PsiBlast_CBE 92.5962%-110 - C15 -2VXA DODEC_HALHL I:[4-67] ----HVYKIVELTGSSPNGIEEAVNNAIARAGETLRHLRWFEVVDTRGHIEGGRVNHWQVTVKVGFTLEG-
30 PsiBlast_CBE 92.5462%-110 - C15 -2VXA DODEC_HALHL C:[4-67] ----HVYKIVELTGSSPNGIEEAVNNAIARAGETLRHLRWFEVVDTRGHIEGGRVNHWQVTVKVGFTLEG-
34 PsiBlast_CBE 92.3753%-109 - C15 -3OQT ? L:[1-70] MSNH-TYRVIEIVGTSPDGVDAAIQGGLARAAQTMRALDWFEVQSIRGHLVDGAVAHFQVTMKVGFRLEDS
42 PsiBlast_CBE 91.3350%-106 - C15 -2YIZ ? B:[1-68] --SNHTYRVIEIVGTSPDGVDAAIQGGLARAAQTMRALDWFEVQSIRGHLVDGAVAHFQVTMKVGFRLED-
22 PsiBlast_CBE 91.2962%-113 - C15 -2VXA DODEC_HALHL K:[4-67] ----HVYKIVELTGSSPNGIEEAVNNAIARAGETLRHLRWFEVVDTRGHIEGGRVNHWQVTVKVGFTLEG-
40 PsiBlast_CBE 91.0050%-104 - C15 -2YIZ ? D:[1-68] --SNHTYRVIEIVGTSPDGVDAAIQGGLARAAQTMRALDWFEVQSIRGHLVDGAVAHFQVTMKVGFRLED-
47 PsiBlast_CBE 89.8149%-107 - C15 -2YJ0 ? B:[2-68] ---NHTYRVIEIVGTSPDGVDAAIQGGLARAAQTMRALDWFEVQSIRGHLVDGAVAHFQVCMKVGFRLED-
106 HHSearch 89.7351%-106 - C15 -2YIZ ? A:[1-68] --SNHTYRVIEIVGTSPDGVDAAIQGGLARAAQTMRALDWFEVQSIRGHLVDGAVAHFQVTMKVGFRLED-
3 PsiBlast_PDB 89.3950%-106 - C15 -2YIZ ? A:[1-68] --SNHTYRVIEIVGTSPDGVDAAIQGGLARAAQTMRALDWFEVQSIRGHLVDGAVAHFQVTMKVGFRLED-
105 HHSearch 87.3748%-106 - C15 -2UX9 DODEC_THET8 A:[2-67] ---GKVYKKVELVGTSEEGLEAAIQAALARARKTLRHLDWFEVKEIRGTIGEAGVKEYQVVLEVGFALE--