@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA0047: (2015-12-19 )
MKATYSMLSQVTFPLAEAGYYVVPVALADETFRQNGLTSAGDVHQVSPAKLREIYGADAALYVTVSDYGTRYMVISSATIVTASAKLVDLRSGTTLWTGSATASSEEGNGGNNGGLVGMLITAAVKQIINSSVEDAGYPIAGMTSARLLSAGQPGGLLYGPRSPRYGSD

Atome Classification :

(20 SA) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------......-...10......-----..-20-..-......30---..-------....-------...40.....--------...50..-----------------..--....60-........70..-----....-------..80........90......---.-..100-----.......110.....---..120.......130-------........140.........150-----......---..--.160-------.......------------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKATYS-MLSQVTFPLAE-----AG-YY-VV-PVALADE----TF-------RQNG-------LTSAGDVHQV--------SPAKLRE-----------------IY--GADAAL-YVTVSDYGTRYM-----VISS-------ATIVTASAKLVDL-RSGTTL---W-TGSAT-----ASSEEGNGGNNGGLV---GMLITAAVKQIINS--------SVEDAGYPI--AGMTSARLLS-------AGQPGG---LL--YGPR-------SPRYGSD------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 90.7851%-100 - C7 -4HRV - ? A:[28-156] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VNGTWG-MLASTAAPLSE-----AG-YY-VF-PAAVVEE----TF-------KQNG-------MTNAADIHAV--------RPEKLHQ-----------------IF--GNDAVL-YITVTEYGT-------------------VTTVSAKARLVDS-RNGKEL---W-SGS-------ASIREGSNNSNSGLL---GMLVSAVVNQIANS--------LT---------------------------------------------------------------------------------------------------------------------------------------------------------------------
25 Fugue 63.1721% -69 - C1 -1TL2 TAL2_TACTR A:[2-236] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GGESMLRGVYQDKFYQGTYPQNK-----ND-NW-LA-RATLIGKGGWSNF-------KFLF-------LSPGGELYGV--------LNDKIYKGTPPTHDNDNWMGRAKKIGNGGWNQFQ-FLFFDPNG-YLY-----AVSK-------DKLYKASP----P-QSDTDN---W-IARAT-----EVGSGGWSGFKFLFFHPNGYLYAVHGQQFYKALPPVSNQDNWLARATKIGQGGWDTFKFLFFSSVGTLFGVQGG---KF--YEDY-------PPSYAYDNWLARAKLIGNGGWDDFRFLFF--------------------------------------------------------------------------------------
32 Fugue 59.9415% -74 * C3 *1D2Z TUBE_DROME B:[1-150] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LSSKYS-RNTELRRVEDN-----DI-YR-LA-KILDENS----CW-------RKLM-------SIIPKGMD--------------VQA-----------------CS--GAGCLN-FPAEIKKGFKYT-----AQDV-------FQIDEAANRLPPD-QSKSQM---M-IDEWK-----TSGKL----NERPTV---GVLLQLLVQAEL----------------FSA--ADFVALDFLN-------ESTPAR---PV--DGPG-------ALISLE-------------------------------------------------------------------------------------------------------------
28 Fugue 56.5613% -75 - C4 -3L42 A:[2-128] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EDSPLD-ALDLVWAKCR-------G-YP-SY-PALIIDP----KM-------PREG-------MFHHGVPIPV--------PPLEVLK-----------------LG--EQMTQE-A-REHLYLVLFF-----DNKR-------TWQWLPRTKLVPL-GVNQDL---D-KEKML-----EGRK-------------------SNIRKSVQI--------AYHRALQHR--SKVQGE------------------------------------------------------------------------------------------------------------------------------------------------------
33 Fugue 53.4711% -67 - C3 -2LC0 - FHAA_MYCTU A:[1-132] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MGSQKR-LVQRVERKLEQ-----T-----------------------------VGD-------AFARIFGGSI--------VPQEVEA-----------------LL--RREAAD-GIQSLQGN-RLL-----APNE-------YIITLGVHDFEKL-GA---------------------------------D---PELKSTGFARDLAD--------YIQEQGWQT--YGDVVVRFEQ-------SSNLHTGQFRA--RGTV-------NPDVETH------------------------------------------------------------------------------------------------------------
31 Fugue 52.5419% -48 - C2 -1AER TOXA_PSEAE A:[1-211] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AFLGDGGDVSFSTRGTQNWTVE-RLLQAHRQLEERGYVFVG-YH-GT-FLEAAQS----IVFGGVRAAIWRG-------FYIAGDPALAYGYAQDQEPDARGRI-----------------RN--GALLRV-YVPRSSLPGFYR-----TSLT-------LAAPEAAGEVERL-IGHPLP---L-RLDAI-----TGPEE-EGGRLETIL---GWPLAERTVVIPSA--------IPTDPRNVG--GDLDPSSIPD-------KEQAIS---ALPDYASQ-------PGKPPR-------------------------------------------------------------------------------------------------------------
26 Fugue 44.1911% -41 - C5 -3RFW - CBF2_CAMJE A:[22-273] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ATVATVNGKSISDTEVSEFFAPMLRGQDFKTLPDNQKKALIQQYIMQDLIL-QDAKKQNLEKD-----PL-YT-KE-LDRAKDA----IL-------VNVY-------QEKILNTIKI--------DAAKVKA-----------------FY--DQNKDK-YVKPARVQAKHI-----LVAT-------EKEAKDIINELKG-LKGKELDAKF-SELAK-----EKSIDPGSKNQGGEL---GWFDQSTMVKPFTD--------AAFALK-----NGTITTTPVK-------TNFGYH---VI--LKEN-------SQAKGQIKFDEVKQGIENGLKFEEFKKVINQKGQDLLNSAKVEYK----------------------------------------------------------------------
13 HHSearch 42.6110% -62 - C7 -3W1E - ? A:[123-222] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GDD-FSRVVNRQLDQ-----TS-RSFVSVGTTD--------Y--------SI------------SSNYPA--------RTQMIAQ-----------------DN--GAQYII-GGVITDLTATVESQLLQDDII-------NRQFALEMKVFDG-KTGHEV---F-NKAYR-----EVARWPFAKTSQVDT---RSARFWASTYGEMM--------LRVSRNIML--DLESELSCKI-------TLPEVV---AV--FGNT-------VTMDLGR------------------------------------------------------------------------------------------------------------
27 Fugue 40.2220% -42 - C4 -4MT1 - ? A:[2-1040] AKFFIDRPIFAWVISIFIIAAGIFGIKSLPVSQYPSVAAPTITLHAIYPGASAQVMEGSVLSVIERNMNGVEGLDYMSTSADSSGSGSVSLTFTPDTDENLAQVEVQNKLSEVLSTLPATVQQYGVTVSKARSNFLMIVMLSSDVQSTEEMNDYAQRNVVPELQRIEGVGQVRLFGAQRAMRIWVDPKKLQNYNLSFADVGSALSAQNIQISAGSIGSLPAVRGQTVTATVTAQGQLGTAEEFGNVILRANTDGSNIYLKDVAKVGLGMEDYSSSTRLNGVNTTGMAVMLSNSGNAMATAKAVKERLAVLEKYFPQGMSWKTPYDTSKFVEISIEKVIHTLIEAMVLVFVVMYLFLQNIRYTLIPTIVVPISLLGGFAFISYMGMSINVLTMFAMILVIGIVVDDAIVVVENVERIMAGEGLPPKEATKKAMGQISGAVIGITAVLISVFVPLAMFSGAAGNIYKQFALTMASSIAFSAFLALTLTPALCATGFFGWFNKKFDSWTHGYEGRVAKVLRKTFRMMVVYIGLAVVGVFLFMRLPTSFLPTEDQGFVMVSVQLPAGATKERTDATLAQVTQLAKSIPEIENIITVSGFSFSGSGQNMAMGFAIFKDWNERTASGSDAVAVAGKLTGMMMGTLKDGFGIAVVPPPILELGSGLSINLQDRNNTGHTALLAKRNELIQKMRASGLFDPSTVRAGGLEDSPQLKIDINRAAAAAQGISFADIRTALASALS-SSYVSDFP--N-----QG-RL-QR-VMVQADE----DA-------RMQPADILNLTVPNKSGVAVP--------LSTIATV-----------------SW--ENGTEQ-SVRFNGYPSMKL-----SASP-------ATGVSTGQAMEAV-QKMVDE---L-GGGYSFEWGGQSSEEAKGGSQTLIL---YGLAVAAVFLVLAA--------LYESWSIPL--AVILVIPLGL-------IGAAAG---VT--GRNLFEGLLGSVPSFANDIYFQVGFVTVMGLSAKNAILIIEFAKDLQAQGKSAVEAALEAARLRFRPIIMTSFAFILGVVPLYIAAGASSASQRAIGTTVFWGMLVGTLLSVFLVPLFYVVVRKFF
11 PsiBlast_PDB 36.3824% -62 * C8 *1F11 - IGH1M_MOUSE B:[60-135] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NQ----KF-------KGKA-------TLTVDKSSST--------AYMQL--------------------T--SEDSAV-YYCANDYGSTYA-----YWGQ-------GTLVTVSAAKTTP-PSVYPL---A-PGSAA-----QTNSMVTLGCLVKGY---FPEPVTVTWNSGSL--------SSGVHTFPA--VLQSDLYTLS-------SSVTVP---SS--PRPS-------ETVTCNV------------------------------------------------------------------------------------------------------------
7 PsiBlast_PDB 36.3830% -36 - C6 -1PVP - RECR_BPP1 A:[243-306] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RKNG-------VAAPSATSQL--------SLSALHG-----------------IF--GATHRLIYGAKDDSGQRYL-----AWSG-------HSARVGAAR--DMARAGVSI---P-EIMQA-----GGWTNVNIVMNYIRN---LDSETGAMVRLLED-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 35.1530% -30 - C6 -1PVQ - RECR_BPP1 A:[243-306] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RKNG-------VAAPSATSQL--------SNSALGG-----------------IF--GATHRLIYGAKDDSGQRYL-----AWSG-------HSARVGAAR--DMARAGVSI---P-EIMQA-----GGWTNVNIVMNYIRN---LDSETGAMVRLLED-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
10 PsiBlast_PDB 34.8629% -56 - C6 -1KGS ? A:[82-142] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ALSDV----EY-------RVKG-------LNMGADDYLP--------KPFDLRE-----------------LI--ARVRAL-IRRKSESKSTKL-----VCGD-------LILDTATKKAYRG-SKEIDL---T-KKEYQ-----ILEYLVMNKNRVVTK---EELQEHLWVFSDVL--------RSHIKNLRK--KVDKGFKKKI-------IHTVRG---IG--YVAR-------DE-----------------------------------------------------------------------------------------------------------------
9 PsiBlast_PDB 34.8230% -31 - C6 -1PVR - RECR_BPP1 A:[243-306] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RKNG-------VAAPSATSQL--------SNSALGG-----------------IF--GATHRLIYGAKDDSGQRYL-----AWSG-------HSARVGAAR--DMARAGVSI---P-EIMQA-----GGWTNVNIVMNYIRN---LDSETGAMVRLLED-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
14 HHSearch 33.5916% -84 - C7 -3LY7 - CADC_ECOLI A:[223-296] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VGDLVATSLNT-----FSTFM-VH-DKINYNI---------------------------------D--------EPSSSGK-----------------TL--SIAFVN-Q--RQY--------------R-------AQQCFMSIKLVDN-ADGSTM---L-DKRYV-----ITN------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
22 HHSearch 33.316% -24 * C6 *3MAB - ? A:[15-46] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VLEQ----DL-------IKAG-------IKTPVELKDV--------GSKEAFL-----------------RI--WENDSS-VCMSELYALEGA-----VQGI-------RWHGLDEAKKIEL-KKFHQS---L-EG-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 32.9526% -45 - C8 -4MHJ - ? H:[61-140] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NQ----KF-------KVRA-------TLTVGRSSST--------AYMDLRS-----------------LT--SEDSAV-YYCVRNYG-SYGYFD--VWGA-------GTTVTVSSAKTTP-PSVYPL---A-PGSAA-----QTNSMVTLGCLVKGY---FPEPVTVTWNSGSL--------SSGVHTFPA--VLQSDLYTLS-------SSVTVP---SS--TWPS-------ETVTCNV------------------------------------------------------------------------------------------------------------
30 Fugue 32.7016% -10 * C4 *4GEQ SPC25_YEAST A:[2-90] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ND-AA-EVALYER----LL-------QLRV-------LPGASDVH-------------DVRF-----------------VF--GDDSRC-WIEVAMHGDHVI-----GNSH-------PALDPKSRATLEH-VLTVQG---D-LAAFL-----VVARDMLLASL----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 31.6826% -44 - C8 -4MHH - ? H:[61-140] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NQ----KF-------KVRA-------TLTVGRSSST--------AYMDLRS-----------------LT--SEDSAV-YYCVRNYGSSYGYFD--VWGA-------GTTVTVSSAKTTP-PSVYPL---A-PGSAA-----QTNSMVTLGCLVKGY---FPEPVTVTWNSGSL--------SSGVHTFPA--VLQSDLYTLS-------SSVTVP---SS--TWPS-------ETVTCNV------------------------------------------------------------------------------------------------------------
18 HHSearch 31.4713% -39 - C7 -2JXP - ? A:[49-110] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KSEAII-QIVHAIREKRIL-----SLSESGRVREFELVYRVAARLLDA-H-NAEL---ASLQEIR-----LTRILPFLDAQELAK---AAEEEMLYKDMQKD--------AVQQILRQV--SAFTSAGLEH-------HHHHH--------------------------------------------------------------------------------------------------------------------------------------