@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA0342: (2015-12-31 )
MKQYLDLMRHVREHGTFKSDRTGTGTYSVFGHQMRFDLAAGFPLVTTKKCHLKSIVHELLWFLKGSTNIAYLKEHGVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANLMAMLKKNPDSRRLIVSAWNPALIDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIASYALLTLMVAQVAGLQPGEFIWTGGDCHLYANHLEQADLQLTREPLPLPSMKLNPEVKDLFDFRFEDFELVGYEAHPHIKAPVAV

Atome Classification :

(94 SA) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------.........10........20........30-........40.........50........60........70........80...------------.------------.-----------------------------...90........100..--------.----------------------------------....110.......120.......130.......140.......150...-.---------...160.......170.......180.......190.......200.......210.......220.......230...---.-----------...240.......250.......260..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLDLMRHVREHGTFKSDRTGTGTYSVFG-HQMRFDLAA-GFPLVTTKKCHLKSIVHELLWFLKGSTNIAYLKEHGVSIWDEWA------------D------------E-----------------------------NGDLGPVYGYQWRSWPAP--------D----------------------------------GRHIDQIANLMAMLKKNPDSRRLIVSAWNPALIDEMALPPCHALFQFYVA-D---------GKLSCQLYQRSADIFLGVPFNIASYALLTLMVAQVAGLQPGEFIWTGGDCHLYANHLEQADLQLTREPLPLPSMKLNPE---V-----------KDLFDFRFEDFELVGYEAHPHIKAPVAV
107 HHSearch 95.1279%-163 - C8 -3IX6 - TYSY_BRUME A:[1-251] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MRTYLDLLQHVLDHGVDRDD----GTRSVFG-YQMRFDLEE-GFPVL---KLHLRSIIHELLWFLKGDTNIAYLKENGVTIWDEWA------------D------------E-----------------------------NGDLGPVYGYQWRSWPAP--------D----------------------------------GRHIDQIANLLKMLHTNPQSRRLIVSAWNPALVDEMALPPCHCLFQFYVA-N---------GRLSCQLYQRSADIFLGVPFNIASYALLTMMIAQVTGLKPGEFIHTLGDAHIYSNHFEQARLQLTRTPKKLPVMHINPD---V-----------KDLFAFRFEDFRLDG-------------
1 PsiBlast_PDB 95.1279%-163 - C8 -3IX6 - TYSY_BRUME A:[1-251] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MRTYLDLLQHVLDHGVDRDD----GTRSVFG-YQMRFDLEE-GFPVL---KLHLRSIIHELLWFLKGDTNIAYLKENGVTIWDEWA------------D------------E-----------------------------NGDLGPVYGYQWRSWPAP--------D----------------------------------GRHIDQIANLLKMLHTNPQSRRLIVSAWNPALVDEMALPPCHCLFQFYVA-N---------GRLSCQLYQRSADIFLGVPFNIASYALLTMMIAQVTGLKPGEFIHTLGDAHIYSNHFEQARLQLTRTPKKLPVMHINPD---V-----------KDLFAFRFEDFRLDG-------------
30 PsiBlast_CBE 92.3569%-142 - C8 -2TSC TYSY_ECOLI B:[1-264] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRA---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
19 PsiBlast_PDB 92.1969%-141 - C8 -3B5B TYSY_ECOLI A:[1-264] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTQRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
3 PsiBlast_PDB 92.1769%-144 - C8 -2KCE TYSY_ECOLI A:[1-264] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
17 PsiBlast_PDB 91.6569%-143 - C8 -2TSC TYSY_ECOLI A:[1-264] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRA---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
4 PsiBlast_PDB 91.5369%-146 - C8 -3TMS TYSY_ECOLI A:[1-264] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
71 PsiBlast_CBE 91.4069%-146 - C8 -1BQ2 TYSY_ECOLI A:[1-264] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFAIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
18 PsiBlast_PDB 91.3169%-143 - C8 -2VET TYSY_ECOLI A:[1-264] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTQRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
31 PsiBlast_CBE 91.2869%-140 - C8 -3B5B TYSY_ECOLI B:[1-264] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTQRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
21 PsiBlast_CBE 91.2769%-142 - C8 -2KCE TYSY_ECOLI B:[1-264] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
2 PsiBlast_PDB 91.0769%-141 - C8 -2BBQ TYSY_ECOLI A:[1-264] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
22 PsiBlast_CBE 90.9669%-142 - C8 -2BBQ TYSY_ECOLI B:[1-264] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
101 HHSearch 90.6363%-147 - C8 -3UWL TYSY_ENTFA A:[2-313] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EEAYLALGKKILEEGHFKEDRTGTGTYSLFG-YQMRFDLAK-GFPLLTTKRVPFGLIKSELLWFLKGDTNIRYLLERNNHIWDEWA------------F------------ERYVKSADYQGEEHQKFCDAILNDAEFAEKYGELGNIYGAQWRHWETK--------D----------------------------------GSFIDQLANVIEMIKTNPDSRRLIVSAWNPEDVPSMALPPCHTMFQFYVN-E---------GKLSCQLYQRSADVFLGVPFNIASYALLTHLIAHETGLEVGEFVHTLGDAHLYQNHVEQMQEQLSREVRSFPTLVLNPD---K-----------ASVFDFDMEDIKVEGYDPHPTIKAPI--
100 PsiBlast_CBE 89.8466%-140 - C8 -4FOA TYSY_MYCTU D:[2-262] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MTPYEDLLRFVLETGTPKSDRTGTGTRSLFG-QQMRYDLSA-GFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWA------------S------------D-----------------------------TGELGPIYGVQWRSWPAP--------S----------------------------------GEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVA-D---------GRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLL-AD---R-----------DSIFEYTYEDIVVKNYDPHPAIKAPV--
104 HHSearch 87.2848%-140 - C8 -1J3K ? C:[45-328] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EYQYLNIIYDIMMNGNKQSDRTGVGVLSKFG-YIMKFDLSQ-YFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANG------------TREFLDNRKLFHRE-----------------------------VNDLGPIYGFQWRHFGAE--------YTNMYDNYE--------------------------NKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVF-D---------GKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPD---I-----------KNIEDFTISDFTIQNYVHHEKISMDMAA
103 HHSearch 87.2555%-147 - C8 -1HW4 TYSY_HUMAN A:[72-352] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ELQYLGQIQHILRCGVRKDDRTGTGTLSVFG-MQARYSLRD-EFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGV---------------------------------------------------------------GDLGPVYGFQWRHFGAE--------YRDMESDYS--------------------------GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVV-N---------SELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRK---V-----------EKIDDFKAEDFQIEGYNPHPTIKME---
110 HHSearch 85.7448%-140 - C8 -3QG2 ? A:[325-608] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EYQYLNIIYDIMMNGNKQSDRTGVGVLSKFG-YIMKFDLSQ-YFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANG------------TREFLDNRKLFHRE-----------------------------VNDLGPIYGFQWRHFGAE--------YTNMYDNYE--------------------------NKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVF-D---------GKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPD---I-----------KNIEDFTISDFTIQNYVHHEKISMDMAA
116 Fugue 85.0252%-139 - C8 -1QZF ? A:[3-521] EKNVSIVVAASVLSSGIGINGQLPWSISEDLKFFSKITNNKCDSNKKNALIMGRKTWDSIGRRPLKNRIIVVISSSLPQDEADPNVVVFRNLEDSIENLMNDDSIENIFVCGGESIYRDALKDNFVDRIYLTRVALEDIEFDTYFPEIPETFLPVYMSQTFCTKNISYDFMIFEKQEKKTLQNCDPARGQLKSIDDTVDLLGEIFGIRKMGNRHKFPKEEIYNTPSIRFGREHYEFQYLDLLSRVLENGAYRENRTGISTYSIFG-QMMRFDMRE-SFPLLTTKKVAIRSIFEELIWFIKGDTNGNHLIEKKVYIWSGNGSKEYLERIGLGHR------------E-----------------------------ENDLGPIYGFQWRHYNGEYKTMHDDYT----------------------------------GVGVDQLAKLIETLKNNPKDRRHILTAWNPSALSQMALPPCHVLSQYYVTND---------NCLSCNLYQRSCDLGLGSPFNIASYAILTMMLAQVCGYEPGELAIFIGDAHIYENHLTQLKEQLSRTPRPFPQLKFKRK---V-----------ENIEDFKWEDIELIGYYPYPTIKMDMAV
108 HHSearch 84.3747%-135 - C8 -2AAZ TYSY_CRYNJ A:[20-317] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EYQYLDLIRRIINVGEVRPDRTGTGTVALFAPPSFRFSLADNTLPLLTTKRVFLRGVIAELLWFVSGCTDAKMLSSQGVGIWDGNG------------SKEFLEKVGLGHRR-----------------------------EGDLGPVYGFQWRHFGAE--------YTDADGDYK--------------------------GKGVDQLQRVIDTIKNNPTDRRIILSAWNPKDLPLMALPPCHMFCQFFVS-LPPADSPGSKPKLSCLMYQRSCDLGLGVPFNIASYALLTHMIALITDTEPHEFILQMGDAHVYRDHVEPLKTQLEREPRDFPKLKWARSKEEI-----------GDIDGFKVEDFVVEGYKPWGKIDMKMSA
113 HHSearch 84.1051%-139 - C8 -3NRR ? A:[232-515] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EFQYLDILADVLSHGVLKPNRTGTDAYSKFG-YQMRFDLSR-SFPLLTTKKVALRSIIEELLWFIKGSTNGNDLLAKNVRIWELNG------------RRDFLDKNGFTDRE-----------------------------EHDLGPIYGFQWRHFGAE--------YLDMHADYT--------------------------GKGIDQLAEIINRIKTNPNDRRLIVCSWNVSDLKKMALPPCHCFFQFYVS-D---------NKLSCMMHQRSCDLGLGVPFNIASYSILTAMVAQVCGLGLGEFVHNLADAHIYVDHVDAVTTQIARIPHPFPRLRLNPD---I-----------RNIEDFTIDDIVVEDYVSHPPIPMAMSA
105 HHSearch 84.0049%-131 - C8 -1F28 TYSY_PNECA A:[6-297] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EQQYLNLVQYIINHGEDRPDRTGTGTLSVFAPSPLKFSLRNKTFPLLTTKRVFIRGVIEELLWFIRGETDSLKLREKNIHIWDANG------------SREYLDSIGLTKRQ-----------------------------EGDLGPIYGFQWRHFGAE--------YIDCKTNYI--------------------------GQGVDQLANIIQKIRTSPYDRRLILSAWNPADLEKMALPPCHMFCQFYVH-IPSNNHR---PELSCQLYQRSCDMGLGVPFNIASYALLTCMIAHVCDLDPGDFIHVMGDCHIYKDHIEALQQQLTRSPRPFPTLSLNRS---I-----------TDIEDFTLDDFNIQNYHPYETIKMKMSI
106 HHSearch 80.9244%-136 - C8 -3V8H ? A:[5-318] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLDLVRTILDTGTWQSN--GIRTIGIPG-AMLRFDLQQ-GFPAVTTKKLAFKSAIGELVGFLRATRSAAEFRALGCKVWDANA------------N------------ENAQWLANPYRRG-----------------ADDLGDVYGVQWRRWPGY--------KVLDAHADAQIADATSRGFRIVARFEEGGADKVLLHKAIDQLRDCLDTIVRDPSSRRILFHGWNPAVLDEIALPACHLLYQFLPN-VER-------REISLCLYIRSNDVGLGTPFNLAEGAALLTLVGRLTGYSPRWFTYFIGDAHIYENQLDMLKQQLEREPFESPRLELAER---VPDYAKTGKYEPQWLERVEPSDFTLVGYRHH---------
77 PsiBlast_CBE 55.1169% -38 - C8 -1FWM TYSY_ECOLI B:[4-264] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQQSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
88 PsiBlast_CBE 55.0969% -37 - C8 -1NCE TYSY_ECOLI B:[4-264] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCCVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
80 PsiBlast_CBE 55.0769% -37 - C8 -1AIQ TYSY_ECOLI A:[4-264] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSERIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
13 PsiBlast_PDB 55.0269% -42 - C8 -1BID TYSY_ECOLI A:[4-265] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
74 PsiBlast_CBE 54.9469% -40 - C8 -1BJG TYSY_ECOLI A:[4-264] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCNVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
16 PsiBlast_PDB 54.9469% -38 - C8 -1SYN TYSY_ECOLI A:[4-265] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
58 PsiBlast_CBE 54.7669% -39 - C8 -1JTU TYSY_ECOLI A:[4-264] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI
7 PsiBlast_PDB 54.7169% -39 - C8 -1TSD TYSY_ECOLI A:[4-265] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKQYLELMQKVLDEGTQKNDRTGTGTLSIFG-HQMRFNLQD-GFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWA------------D------------E-----------------------------NGDLGPVYGKQWRAWPTP--------D----------------------------------GRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA-D---------GKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK---P-----------ESIFDYRFEDFEIEGYDPHPGIKAPVAI