@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA0357: (2016-01-01 )
MPELPEVETTRRGIAPYLEGQRVERVIVRERRLRWPIPEDLDVRLSGQRIVSVERRAKYLLLGAEAGTLISHLGMSGSLRLVESGTPASRHEHVDIELASGMALRYTDPRRFGAMLWSLAPLEHELLRNLGPEPLTDAFAGQRLFELSRGRSMAVKPFIMDNAVVVGVGNIYASEALFAAGIDPRKPAGSISKARYLRLAEEIKRILAIAIERGGTTLRDFVGGDGQPGYFQQELFVYGRGGEFCKVCGSTLREIRLGQRASVYCPRCQR

Atome Classification :

(34 SA) .........10........20........30......----..40..---......50........60..-.....---.70........80........90........100.......110......-.120---.....---...130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MPELPEVETTRRGIAPYLEGQRVERVIVRERRLRWPI----PEDLDV---RLSGQRIVSVERRAKYLLLG-AEAGT---LISHLGMSGSLRLVESGTPASRHEHVDIELASGMALRYTDPRRFGAMLWS-LAP----LEHEL---LRNLGPEPLTDAFAGQRLFELSRGRSMAVKPFIMDNAVVVGVGNIYASEALFAAGIDPRKPAGSISKARYLRLAEEIKRILAIAIERGGTTLRDFVGGDGQPGYFQQELFVYGRGGEFCKVCGSTLREIRLGQRASVYCPRCQR
22 PsiBlast_CBE 92.7354%-101 - C12 -1K82 FPG_ECOLI C:[1-268] -PELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPV----SEEI-Y---RLSDQPVLSVQRRAKYLLLE-LPEGW---IIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWT-KEL----EGHNV---LTHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLK--------PGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK
23 PsiBlast_CBE 92.4454%-104 - C12 -1K82 FPG_ECOLI B:[1-268] -PELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPV----SEEI-Y---RLSDQPVLSVQRRAKYLLLE-LPEGW---IIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWT-KEL----EGHNV---LTHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLK--------PGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK
1 PsiBlast_PDB 92.1654% -99 - C12 -1K82 FPG_ECOLI A:[1-268] -PELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPV----SEEI-Y---RLSDQPVLSVQRRAKYLLLE-LPEGW---IIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWT-KEL----EGHNV---LTHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLK--------PGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK
68 Fugue 92.0855% -95 - C12 -1K82 FPG_ECOLI A:[1-268] -PELPEVETSRRGIEPHLVGATILHAVVRNGRLRWP-V---SEEIYR----LSDQPVLSVQRRAKYLLLEL-PEGW---IIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTK-EL----EGHNV---LTHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTL--------KPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK
21 PsiBlast_CBE 91.4754% -99 - C12 -1K82 FPG_ECOLI D:[1-268] -PELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPV----SEEI-Y---RLSDQPVLSVQRRAKYLLLE-LPEGW---IIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWT-KEL----EGHNV---LTHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLK--------PGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK
78 HHSearch 90.6654% -90 - C12 -1K82 FPG_ECOLI A:[1-268] -PELPEVETSRRGIEPHLVGATILHAVVRNGRLRWP-----VSEEIY---RLSDQPVLSVQRRAKYLLLE-LPEGW---IIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWT-KEL----EGHNV---LTHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLK--------PGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRATFYCRQCQK
12 PsiBlast_PDB 85.3240% -85 - C12 -2F5Q ? A:[2-274] -PQLPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
19 PsiBlast_PDB 85.0340% -84 - C12 -3GPY ? A:[1-273] -PQLPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
11 PsiBlast_PDB 84.7540% -86 - C12 -1R2Z ? A:[2-274] -PQLPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
10 PsiBlast_PDB 84.5340% -85 - C12 -1R2Y ? A:[2-274] -PQLPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
6 PsiBlast_PDB 83.7740% -89 - C12 -1L2D ? A:[2-274] -PELPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGS--------------FQHHLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
20 PsiBlast_PDB 83.7540% -85 - C12 -3GQ4 ? A:[1-273] -PQLPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
40 PsiBlast_CBE 83.4539% -85 - C12 -3JR5 ? A:[1-273] -PQLPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGCIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
13 PsiBlast_PDB 83.4240% -86 - C12 -2F5S ? A:[2-274] -PQLPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
41 PsiBlast_CBE 83.1139% -88 - C12 -3JR4 ? A:[1-273] -PQLPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGCIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGST----------AGTFQHHLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
30 PsiBlast_CBE 83.0040% -94 - C12 -3U6S ? A:[1-273] -PQLPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVM---------------------HLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
8 PsiBlast_PDB 82.9440% -96 - C12 -2F5O ? A:[2-274] -PELPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVM---------------------HLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
32 PsiBlast_CBE 82.9040% -95 - C12 -3U6P ? A:[1-273] -PQLPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVM---------------------HLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
5 PsiBlast_PDB 82.8240% -89 - C12 -1L2C ? A:[2-274] -PELPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGS--------------FQHHLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
16 PsiBlast_PDB 82.7540% -96 - C12 -3SAV ? A:[1-273] -PELPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVM---------------------HLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
14 PsiBlast_PDB 82.6540% -97 - C12 -3SAR ? A:[1-273] -PELPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMK--------------------HLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
4 PsiBlast_PDB 81.9540% -89 - C12 -1L2B ? A:[2-274] -PELPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVR---------GTFQHHLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
28 PsiBlast_CBE 81.7440% -92 - C12 -3SAS ? A:[1-273] -PELPEVETIRRTLLPLIVGKTIEDV-----RIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFL-LDRDA---LISHLRMEGRYAVASALEPLEPHTHVVFCFTDGSELRYRDVAKFGTM-HV-YAK----EEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVKALLLDCTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMK--------------------HLYVYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
49 PsiBlast_CBE 80.3035% -77 - C12 -3C58 FPG_LACLC A:[1-270] -PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTG----FEQLKK---ELTGKTIQGISRRGKYLIFEIGDDFR---LISHLRMEGKYRLATLDAPREKHDHLTMKFADGQ-LIYADVRKFGT--WE-LISTDQVLPYFL---KKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIR---SALGSTGKMQNELQVYGKTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQ
51 PsiBlast_CBE 80.2735% -77 - C12 -2XZF FPG_LACLC A:[1-270] -PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTG----FEQLKK---ELTGKTIQGISRRGKYLIFEIGDDFR---LISHLRMEGKYRLATLDAPREKHDHLTMKFADGQ-LIYADVRKFGT--WE-LISTDQVLPYFL---KKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGS------SALGSTGKMQNELQVYGKTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQ
46 PsiBlast_CBE 80.1635% -84 - C12 -4CIS ? A:[2-271] -PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTG----FEQLKK---ELTGKIIQGIIRRGKYLIFEIGDDFR---LISHLRMEGKYRLATLDAPREKHDHLTMKFSDGQ-LIYADVRKFGT--WE-LISTDQVLPYFL---NKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKEANQLIESSIHLLHDSIIEILQKAIKLGGSSI---------TGKMQNELQVYGKTGEKCSRCGAEIQKIKVAGRGTHFCPFCQQ
44 PsiBlast_CBE 80.1035% -82 - C12 -1TDZ FPG_LACLC A:[3-271] --ELPEVETVRRELEKRIVGQKIISIEATYPRMVLTG----FEQLKK---ELTGKTIQGISRRGKYLIFEIGDDFR---LISHLRMEGKYRLATLDAPREKHDHLTMKFADGQ-LIYADVRKFGT--WE-LISTDQVLPYFL---KKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSI------LGSTGKMQNELQVYGKTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQ
50 PsiBlast_CBE 79.3635% -76 - C12 -2XZU FPG_LACLC A:[1-270] -PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTG----FEQLKK---ELTGKTIQGISRRGKYLIFEIGDDFR---LISHLRMEGKYRLATLDAPREKHDHLTMKFADGQ-LIYADVRKFGT--WE-LISTDQVLPYFL---KKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGS------SALGSTGKMQNELQVYGKTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQ