@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA0650: (2016-01-13 )
MDIKGALNRIVNQLDLTTEEMQAVMRQIMTGQCTDAQIGAFLMGMRMKSETIDEIVGAVAVMRELADGVQLPTLKHVVDVVGTGGDGANIFNVSSAASFVVAAAGGKVAKHGNRAVSGKSGSADLLEAAGIYLELTSEQVARCIDTVGVGFMFAQVHHKAMKYAAGPRRELGLRTLFNMLGPLTNPAGVRHQVVGVFTQELCKPLAEVLKRLGSEHVLVVHSRDGLDEFSLAAATHIAELKDGEVREYEVRPEDFGIKSQTLMGLEVDSPQASLELIRDALGRRKTEAGQKAAELIVMNAGPALYAADLATSLHEGIQLAHDALHTGLAREKMDELVAFTAVYREENAQ

Atome Classification :

(42 SA) .........10........20........30........40........50........60........70..-...-...80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.....-..270.-......280.......290.......300....-------...310-........320.......330.......340.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MDIKGALNRIVNQLDLTTEEMQAVMRQIMTGQCTDAQIGAFLMGMRMKSETIDEIVGAVAVMRELADGVQLPT-LKH-VVDVVGTGGDGANIFNVSSAASFVVAAAGGKVAKHGNRAVSGKSGSADLLEAAGIYLELTSEQVARCIDTVGVGFMFAQVHHKAMKYAAGPRRELGLRTLFNMLGPLTNPAGVRHQVVGVFTQELCKPLAEVLKRLGSEHVLVVHSRDGLDEFSLAAATHIAELKDGEVREYEVRPEDFGIKSQTLMGLEV-DSPQAS-LELIRDALGRRKTEAGQKAAELIVMNAGPALYA-------ADLAT--SLHEGIQLAHDALHTGLAREKMDELVAFTAVYREENAQ
1 PsiBlast_PDB 96.3159%-114 - C11 -4YI7 ? A:[18-361] -NIQQALNHITKNIHLTQAQMEDVMRSIMQGEATEAQIGALMMGLRMKGESIDEITAAARVMRELAIKIDVSD-IQY-LVDIVGTGGD--NLFNVSTASSFVIAAAGATIAKHGNR-------SSDLLEQAGINLDLDMQQTERCIREMGVGFLFA------MKYAVGPRRELGIRSIFNLLGPLTNPAGVKRFVIGVFSDELCRPIAEVMKQLGAEHVMVVHSKDGLDEISLASQTYIAELKNGEVTEWVLNPEDVNIPSQTLSGLIV-EDSNAS-LKLIKDALGRKKSDIGEKAANMIALNAGAGIYV-------SGLAT--SYKQGVALAHDIIYGGQALEKMSILSEFTKALKE----
2 PsiBlast_PDB 88.0447%-114 - C11 -4HKM TRPD_XANCP A:[9-339] -----ALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGAATVMREFSRRVEVTD-RRH-MVDIVGT------TFNISTCAMFVAAAGGAKVAKHG---------SADALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFNILGPLTNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVGELRDGQVHEYEVHPEDFGIAMSA------AESRAML-LQVLDNVPG--------PALDIVALNAGAALYV-------AGVAD--SIADGIVRARQVLADGSARACLDAYVAFTQQATA----
105 HHSearch 86.4341% -96 * C11 *2ELC TRPD_THET8 A:[2-328] ----DAVKKAILGEVLEEEEAYEVMRALMAGEVSPVRAAGLLVALSLRGERPHEIAAMARAMREAARPLRVHR--RP-LLDIVGTGGDGKGLMNLSTLAALVAAAGGVAVAKHGNRAASSRAGSADLLEALGVDLEAPPERVGEAIEELGFGFLFARVFHPAMRHVAPVRAELGVRTVFNLLGPLTNPAGADAYVLGVFSPEWLAPMAEALERLGA-RGLVVHG-EGADELVL-GENRVVEVGKG---AYALTPEEVGLKRAPLEALKG-GGPEEN-AALARRLLKGEE---KGPLADAVALAAGAGFYA-------AGKTP--SLKEGVALAREVLASGEAYLLLERYVAFLRA-------
44 PsiBlast_CBE 85.4039%-100 - C11 -4OWN TRPD_MYCTU B:[31-366] ------LGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADT-VPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAAS-LSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSS-VLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAG-GDAQAN-AAAVRAVLGGARG----PVRDAVVLNAAGAIVAHAGLSSRAEWLP--AWEEGLRRASAAIDTGAAEQLLARWVRFGRQIL-----
15 PsiBlast_PDB 85.0939% -95 - C11 -4GIU TRPD_MYCTU A:[31-366] ------LGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADT-VPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSS-VLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAG-GDAQAN-AAAVRAVLGGARG----PVRDAVVLNAAGAIVAHAGLSSRAEWLP--AWEEGLRRASAAIDTGAAEQLLARWVRFGRQ-------
102 HHSearch 84.8034% -94 - C11 -1VQU TRPD2_NOSS1 A:[25-374] TSWYLLLQQLIDGESLSRSQAAELMQGWLSEAVPPELSGAILTALNFKGVSADELTGMAEVLQSQSKM---TNSPFS-IIDTCGTG---SSTFNISTAVAFVAAAYGVPVAKHGNR--SSLTGSADVLEALGVNLGASPEKVQAALQEVGITFLFAPGWHPALKAVATLRRTLRIRTVFNLLGPLVNPLRPTGQVVGLFTPKLLTTVAQALDNLGKQKAIVLHGRERLDEAGLGDLTDLAVLSDGELQLTTINPQEVGVTPAPIGALRG-GDVQEN-AEILKAVLQGKG---TQAQQDAVALNAALALQV-------AGAVPLLDHAQGVSVAKEILQTGTAWAKLAQLVYFLGN-------
18 PsiBlast_PDB 84.8039% -96 - C11 -4OWQ TRPD_MYCTU A:[31-366] ------LGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADT-VPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSS-VLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAG-GDAQAN-AAAVRAVLGGARG----PVRDAVVLNAAGAIVAHAGLSSRAEWLP--AWEEGLRRASAAIDTGAAEQLLARWVRFGRQI------
45 PsiBlast_CBE 84.7839% -99 - C11 -4OWM TRPD_MYCTU B:[31-366] ------LGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADT-VPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAA--LSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSS-VLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAG-GDAQAN-AAAVRAVLGGARG----PVRDAVVLNAAGAIVAHAGLSSRAEWLP--AWEEGLRRASAAIDTGAAEQLLARWVRFGRQILE----
50 PsiBlast_CBE 84.7739% -97 - C11 -3TWP TRPD_MYCTU D:[30-365] ------LGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADT-VPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSS-VLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAG-GDAQAN-AAAVRAVLGGAR----GPVRDAVVLNAAGAIVAHAGLSSRAEWLP--AWEEGLRRASAAIDTGAAEQLLARWVRFGRQI------
68 PsiBlast_CBE 84.7439% -96 - C11 -3QQS TRPD_MYCTU A:[30-365] ------LGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADT-VPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSS-VLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAG-GDAQAN-AAAVRAVLGGAR----GPVRDAVVLNAAGAIVAHAGLSSRAEWLP--AWEEGLRRASAAIDTGAAEQLLARWVRFGRQI------
56 PsiBlast_CBE 84.6939% -99 - C11 -3R6C TRPD_MYCTU B:[30-365] ------LGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADT-VPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSS-VLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAG-GDAQAN-AAAVRAVLGGAR----GPVRDAVVLNAAGAIVAHAGLSSRAEWLP--AWEEGLRRASAAIDTGAAEQLLARWVRFGRQI------
66 PsiBlast_CBE 84.6739% -96 - C11 -3QQS TRPD_MYCTU C:[30-365] ------LGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADT-VPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAAS-LSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSS-VLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAG-GDAQAN-AAAVRAVLGGAR----GPVRDAVVLNAAGAIVAHAGLSSRAEWLP--AWEEGLRRASAAIDTGAAEQLLARWVRFGR--------
65 PsiBlast_CBE 84.6539% -97 - C11 -3QR9 TRPD_MYCTU A:[30-365] ------LGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADT-VPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSS-VLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAG-GDAQAN-AAAVRAVLGGAR----GPVRDAVVLNAAGAIVAHAGLSSRAEWLP--AWEEGLRRASAAIDTGAAEQLLARWVRFGRQIL-----
61 PsiBlast_CBE 84.6539% -97 - C11 -3QS8 TRPD_MYCTU C:[30-365] ------LGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADT-VPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSS-VLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAG-GDAQAN-AAAVRAVLGGAR----GPVRDAVVLNAAGAIVAHAGLSSRAEWLP--AWEEGLRRASAAIDTGAAEQLLARWVRFGRQI------
71 PsiBlast_CBE 84.6439% -97 - C11 -4GKM TRPD_MYCTU B:[32-367] ------LGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADT-VPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSS-VLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAG-GDAQAN-AAAVRAVLGGARG----PVRDAVVLNAAGAIVAHAGLSSRAEWLP--AWEEGLRRASAAIDTGAAEQLLARWVRFGRQI------
57 PsiBlast_CBE 84.5939% -97 - C11 -3R6C TRPD_MYCTU A:[30-365] ------LGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADT-VPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSS-VLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAG-GDAQAN-AAAVRAVLGGAR----GPVRDAVVLNAAGAIVAHAGLSSRAEWLP--AWEEGLRRASAAIDTGAAEQLLARWVRFGRQI------
20 PsiBlast_PDB 84.4839% -97 - C11 -4OWU TRPD_MYCTU A:[31-366] ------LGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADT-VPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSS-VLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAG-GDAQAN-AAAVRAVLGGARG----PVRDAVVLNAAGAIVAHAGLSSRAEWLP--AWEEGLRRASAAIDTGAAEQLLARWVRFGRQI------
49 PsiBlast_CBE 84.4539%-100 - C11 -3UU1 TRPD_MYCTU C:[30-365] ------LGRLTDNRDLARGQAAWAMDQIMTGNARP