@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA0923: (2016-01-25 )
MRKIIHIDCDCFYAALEMRDDPSLRGKALAVGGSPDKRGVVATCSYEARAYGVRSAMAMRTALKLCPDLLVVRPRFDVYRAVSKQIHAIFRDYTDLIEPLSLDEAYLDVSASPHFAGSATRIAQDIRRRVAEELHITVSAGVAPNKFLAKIASDWRKPDGLFVITPEQVDGFVAELPVAKLHGVGKVTAERLARMGIRTCADLRQGSKLSLVREFGSFGERLWGLAHGIDERPVEVDSRRQSVSVECTFDRDLPDLAACLEELPTLLEELDGRLQRLDGSYRPDKPFVKLKFHDFTQTTVEQSGAGRDLESYRQLLGQAFARGNRPVRLIGVGVRLLDLQGAHEQLRLF

Atome Classification :

(22 SA) -------------------------------------------------------------------.........10........20........30.....-------------------------------...40........50........60........70...-.....80........90........100.......110-------------------....-------------------..---------------..120.......130.......140.......150.......160....--...170....-...180.......190.......200.......210......-.220.......230.......240.......250.......260.......270.......280.......290..---------.------....300....---------..----.310.......320.-...-------....330...-....340.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -------------------------------------------------------------------MRKIIHIDCDCFYAALEMRDDPSLRGKALAVGGSPD-------------------------------KRGVVATCSYEARAYGVRSAMAMRTALKLCPDLLVVRP-RFDVYRAVSKQIHAIFRDYTDLIEPLSLDEAYLDVSA--------------------SPHF-------------------AG---------------SATRIAQDIRRRVAEELHITVSAGVAPNKFLAKIASDWRKPDGLFVITP--EQVDGFVAEL-PVAKLHGVGKVTAERLARMGIRTCADLRQGSKLSLVREFGSF-GERLWGLAHGIDERPVEVDSRRQSVSVECTFDRDLPDLAACLEELPTLLEELDGRLQRLDGSYRPDKPFVKLKFHD---------F------TQTTVEQSGAG---------RD----LESYRQLLGQAF-AR-GNR-------PVRLIGVGVR-LLDLQGAHEQLRLF
26 PsiBlast_CBE 95.5449%-123 - C3 -4IRK DPO4_ECOLI A:[3-341] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQTTQEHVWPR---------LNKADLIATARKTWDE---RR-GGR-------GVRLVGLHVT-LLDP----------
29 PsiBlast_CBE 95.1749%-127 - C3 -4R8U ? B:[1-337] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQTTQEHVWPR---------LNKADLIATARKTWDE---RR-GGR-------GVRLVGLHVT-LD------------
21 PsiBlast_CBE 94.8749%-119 - C3 -4Q43 DPO4_ECOLI F:[3-342] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQTTQEHVWPR---------LNKADLIATARKTWDE---RR-GGR-------GVRLVGLHVT-LLDP----------
9 PsiBlast_PDB 94.7749%-120 - C3 -4Q45 DPO4_ECOLI F:[3-341] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQTTQEHVWPR---------LNKADLIATARKTWDE---RR-GGR-------GVRLVGLHVT-LLDP----------
4 PsiBlast_PDB 94.7749%-124 - C3 -4R8U DPO4_ECOLI A:[2-340] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQTTQEHVWPR---------LNKADLIATARKTWDE---RR-GGR-------GVRLVGLHVT-LLD-----------
1 PsiBlast_PDB 94.7249%-121 - C3 -4IR1 DPO4_ECOLI F:[3-342] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQTTQEHVWPR---------LNKADLIATARKTWDE---RR-GGR-------GVRLVGLHVT-LLDP----------
5 PsiBlast_PDB 94.6749%-120 - C3 -4IRC DPO4_ECOLI F:[3-341] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQTTQEHVWPR---------LNKADLIATARKTWDE---RR-GGR-------GVRLVGLHVT-LLDP----------
2 PsiBlast_PDB 94.6549%-121 - C3 -4IR9 DPO4_ECOLI F:[3-342] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQTTQEHVWPR---------LNKADLIATARKTWDE---RR-GGR-------GVRLVGLHVT-LLDP----------
8 PsiBlast_PDB 94.5749%-121 - C3 -4Q44 DPO4_ECOLI A:[3-341] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQTTQEHVWPR---------LNKADLIATARKTWDE---RR-GGR-------GVRLVGLHVT-LLDP----------
3 PsiBlast_PDB 94.1649%-123 - C3 -4Q43 DPO4_ECOLI A:[3-342] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQTTQEHVWPR---------LNKADLIATARKTWDE---RR-GGR-------GVRLVGLHVT-LLDP----------
6 PsiBlast_PDB 94.1049%-116 - C3 -4IRD DPO4_ECOLI F:[3-341] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQTTQEHVWPR---------LNKADLIATARKTWDE---RR-GGR-------GVRLVGLHVT-LLDP----------
24 PsiBlast_CBE 93.9449%-121 - C3 -4Q45 DPO4_ECOLI A:[3-341] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQTTQEHVWPR---------LNKADLIATARKTWDE---RR-GGR-------GVRLVGLHVT-LLDP----------
7 PsiBlast_PDB 93.9149%-122 - C3 -4IRK DPO4_ECOLI B:[3-341] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQTTQEHVWPR---------LNKADLIATARKTWDE---RR-GGR-------GVRLVGLHVT-LLDP----------
27 PsiBlast_CBE 93.4949%-122 - C3 -4IRD DPO4_ECOLI A:[3-341] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALALCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQACDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQTTQEHVWPR---------LNKADLIATARKTWDE---RR-GGR-------GVRLVGLHVT-LLDP----------
22 PsiBlast_CBE 93.3649%-120 - C3 -4IR9 DPO4_ECOLI A:[3-342] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQTTQEHVWPR---------LNKADLIATARKTWDE---RR-GGR-------GVRLVGLHVT-LLDP----------
23 PsiBlast_CBE 93.2849%-120 - C3 -4IR1 DPO4_ECOLI A:[3-342] --------------------------------------------------------------------RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRE-------------------------------RRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPG-RFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTD--------------------SVHC-------------------HG---------------SATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITP--AEVPAFLQTL-PLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKF-GRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDD---------F------QQ