@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA1197: (2016-01-27 )
MDSHSPIATVAQALRRAERILVITGAGLSADSGMPTYRGLGGLYNGRTEEGLPIEAALSGPMLRRDPALCWKYLAELGKACLAARPNAGHEAIAELQKHKPECWVLTQNIDGFHRQAGSPAERLIEIHGELAPLYCQSCGAESGGLEEHLHGQLPPRCAACGGVLRPPVVLFEEMLPEEAIDTLYRELRKGFDAVLVVGTTASFPYIVEPVLRTRQAGGFTAEVNPGVTDLSERVDVKMTGRALDIMPQVVSHIYR

Atome Classification :

(43 SA) ----------------------------------------------------------------------------.........10........20........30........40........50-...-......60........70........80........90....----...----.100.......110.......120.......130.......140.-------------------.---......-------------------.150...--...--.160..-----.-......170.......180.......--190.......200-----.-.-..-....210---........220...---....230...-----....240.......250....-----------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ----------------------------------------------------------------------------MDSHSPIATVAQALRRAERILVITGAGLSADSGMPTYRGLGGLYNGRTEE--GLP-IEAALSGPMLRRDPALCWKYLAELGKACLAARPNAGHEAIAE----LQK----HKPECWVLTQNIDGFHRQAGSPAERLIEIHGELAPLYCQSCG--A-------------------E---SGGLEE-------------------HLHGQLP--PRC--AA--CG-----G-VLRPPVVLFEEMLPEEAIDTLYRELR--KGFDAVLVVGTT------A-S-FP-YIVEPV----LRTRQAGGFTAEVN---PGVTDLSERV-----DVKMTGRALDIMPQVVSHIYR-----------------------------------
10 PsiBlast_PDB 89.0636%-102 - C4 -4TWJ NPD2_ARCFU A:[5-248] ----------------------------------------------------------------------------------IRKAAEILAKSKHAVVFTGAGISAE-----------------PE--EV----ASISG--FKRNPRAFWEFSMEM-KDKLFAEPNPAHYAIAE----LER----MGIVKAVITQNIDMLHQRAGS--RRVLELHGSMDKLDCLDCH--E-------------------TYDWSEFVED-------------------FNKGEI---PRC--RK--CG-----SYYVKPRVVLFGEPLPQR---TLFEAIEEAKHCDAFMVVGSSLVVYPAA-E-LP-YI----------AKKAGAKMIIVN---AEPTMADPIF-----DVKIIGKAGEVLPKIVEEVKR-----------------------------------
23 PsiBlast_CBE 88.3836% -94 - C4 -1YC2 NPD2_ARCFU E:[5-248] ----------------------------------------------------------------------------------IRKAAEILAKSKHAVVFTGAGISAESGIPTFRGEDGLWRKYDPE--EV----ASISG--FKRNPRAFWEFSMEM-KDKLFAEPNPAHYAIAE----LER----MGIVKAVITQNIDMLHQRAGS--RRVLELHGSMDKLDCLDCH--E-------------------TYDWSEFVED-------------------FNKGEI---PRC--RK--CG-----SYYVKPRVVLFGEPLPQR---TLFEAIEEAKHCDAFMVVGSSLVVYPAA-E-LP-YI----------AKKAGAKMIIVN---AEPTMADPIF-----DVKIIGKAGEVLPKIVEEVKR-----------------------------------
107 HHSearch 88.3734% -96 - C4 -3RIY SIR5_HUMAN A:[7-273] ------------------------------------------------------------------------------PSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRK-------WQ-AQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAE----CETRLGKQGRRVVVITQNIDELHRKAGTK--NLLEIHGSLFKTRCTSCG--V-------------------V---AENYKSPICPALSGKGAPEPGTQDASIPVEKL--PRC--EEAGCG-----G-LLRPHVVWFGENLDPAILEEVDRELA--H-CDLCLVVGTS------S-VVYP-AAMFAP----Q-VAARGVPVAEFN---TETTPATNRF-----RFHFQGPCGTTLPEALA---------------------------------------
26 PsiBlast_CBE 87.8336% -95 - C4 -1YC2 NPD2_ARCFU B:[5-248] ----------------------------------------------------------------------------------IRKAAEILAKSKHAVVFTGAGISAESGIPTFRGEDGLWRKYDPE--EV----ASISG--FKRNPRAFWEFSMEM-KDKLFAEPNPAHYAIAE----LER----MGIVKAVITQNIDMLHQRAGS--RRVLELHGSMDKLDCLDCH--E-------------------TYDWSEFVED-------------------FNKGEI---PRC--RK--CG-----SYYVKPRVVLFGEPLPQR---TLFEAIEEAKHCDAFMVVGSSLVVYPAA-E-LP-YI----------AKKAGAKMIIVN---AEPTMADPIF-----DVKIIGKAGEVLPKIVEEVKR-----------------------------------
27 PsiBlast_CBE 87.4436% -87 - C4 -1S7G NPD2_ARCFU E:[5-248] ----------------------------------------------------------------------------------IRKAAEILAKSKHAVVFTGAGISAESGIPTFRGEDGLWRKYDPE--EV----ASISG--FKRNPRAFWEFSMEM-KD--FAEPNPAHYAIAE----LER----MGIVKAVITQNIDMLHQRAGS--RRVLELHGSMDKLDCLDCH--E-------------------TYDWSEFVED-------------------FNKGEI---PRC--RK--CG-----SYYVKPRVVLFGEPLPQR---TLFEAIEEAKHCDAFMVVGSSLVVYPAA-E-LP-YI----------AKKAGAKMIIVN---AEPTMADPIF-----DVKIIGKAGEVLPKIVEEVKR-----------------------------------
29 PsiBlast_CBE 87.4136% -94 - C4 -1S7G NPD2_ARCFU B:[5-248] ----------------------------------------------------------------------------------IRKAAEILAKSKHAVVFTGAGISAESGIPTFRGEDGLWRKYDPE--EV----ASISG--FKRNPRAFWEFSMEM-KDKLFAEPNPAHYAIAE----LER----MGIVKAVITQNIDMLHQRAGS--RRVLELHGSMDKLDCLDCH--E-------------------TYDWSEFVED-------------------FNKGEI---PRC--RK--CG-----SYYVKPRVVLFGEPLPQR---TLFEAIEEAKHCDAFMVVGSSLVVYPAA-E-LP-YI----------AKKAGAKMIIVN---AEPTMADPIF-----DVKIIGKAGEVLPKIVEEVKR-----------------------------------
25 PsiBlast_CBE 87.2736% -91 - C4 -1YC2 NPD2_ARCFU C:[5-248] ----------------------------------------------------------------------------------IRKAAEILAKSKHAVVFTGAGISAESGIPTFRGEDGLWRKYDPE--EV----ASISG--FKRNPRAFWEFSMEM-KDKLFAEPNPAHYAIAE----LER----MGIVKAVITQNIDMLHQRAGS--RRVLELHGSMDKLDCLDCH--E-------------------TYDWSEFVED-------------------FNKGEI---PRC--RK--CG-----SYYVKPRVVLFGEPLPQR---TLFEAIEEAKHCDAFMVVGSSLVVYPAA-E-LP-YI----------AKKAGAKMIIVN---AEPTMADPIF-----DVKIIGKAGEVLPKIVEEVKR-----------------------------------
28 PsiBlast_CBE 86.4736% -90 - C4 -1S7G NPD2_ARCFU C:[5-248] ----------------------------------------------------------------------------------IRKAAEILAKSKHAVVFTGAGISAESGIPTFRGEDGLWRKYDPE--EV----ASISG--FKRNPRAFWEFSMEM-KDKLFAEPNPAHYAIAE----LER----MGIVKAVITQNIDMLHQRAGS--RRVLELHGSMDKLDCLDCH--E-------------------TYDWSEFVED-------------------FNKGEI---PRC--RK--CG-----SYYVKPRVVLFGEPLPQR---TLFEAIEEAKHCDAFMVVGSSLVVYPAA-E-LP-YI----------AKKAGAKMIIVN---AEPTMADPIF-----DVKIIGKAGEVLPKIVEEVKR-----------------------------------
14 PsiBlast_PDB 86.4632% -96 - C4 -4F56 SIR5_HUMAN A:[9-273] --------------------------------------------------------------------------------SSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQ--DLA-TPLAFA-----HNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGK----QGRRVVVITQNIDELHRKAGT--KNLLEIHGSLFKTRCTSCG--VVAENYKSPICPALSGKGAPE---PGTQDA-------------------SIPVEKL--PRCEEAG--CG-----G-LLRPHVVWFGENLDPAILEEVDRELA--H-CDLCLVVGTS------SVV-YPAAMFAPQ----VAAR--GVPVAEFN---TETTPATNRF-----RFHFQGPCGTTLPEALA---------------------------------------
13 PsiBlast_PDB 86.1632% -99 - C4 -4F4U SIR5_HUMAN A:[9-273] --------------------------------------------------------------------------------SSMADFRKFFAKAKHIVIISGAGVSAESGVPTF----GYWRKWQAQ--DLA-TPLAFA-----HNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGK----QGRRVVVITQNIDELHRKAGT--KNLLEIHGSLFKTRCTSCG--VVAENYKSPICPALSGKGAPE---PGTQDA-------------------SIPVEKL--PRCEEAG--CG-----G-LLRPHVVWFGENLDPAILEEVDRELA--H-CDLCLVVGTS------SVV-YPAAMFAPQ----VAAR--GVPVAEFN---TETTPATNRF-----RFHFQGPCGTTLPEALA---------------------------------------
31 PsiBlast_CBE 85.8332% -95 - C4 -3RIY SIR5_HUMAN B:[9-273] --------------------------------------------------------------------------------SSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQ--DLA-TPLAFA-----HNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGK----QGRRVVVITQNIDELHRKAGT--KNLLEIHGSLFKTRCTSCG--VVAENYKSPICPALSGKGAPE---PGTQDA-------------------SIPVEKL--PRCEEAG--CG-----G-LLRPHVVWFGENLDPAILEEVDRELA--H-CDLCLVVGTS------SVV-YPAAMFAPQ----VAAR--GVPVAEFN---TETTPATNRF-----RFHFQGPCGTTLPEALA---------------------------------------
99 Fugue 85.7626% -99 - C4 -5BTR ? A:[4-390] DNLLFGDEIITNGSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQESKKIIVLTGAGVSVSSGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPG--QFQPSLCHKFIAL----SDK----EGKLLRNYTQNIDTLEQVAG--IQRIIQCHGSFATASCLICKYKV-------------------D---CEAVRG-------------------DIFNQVV--PRC--PR--CPADEPLA-IMKPEIVFFGENLP-EQFHRAMKYDK--DEVDLLIVIGSS-----------------------LKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLSSNPVKLSEITEQYLFLPPNRYIFHGAEVY
9 PsiBlast_PDB 85.7536% -93 - C4 -1YC2 NPD2_ARCFU A:[5-248] ----------------------------------------------------------------------------------IRKAAEILAKSKHAVVFTGAGISAESGIPTFRGEDGLWRKYDPE--EV----ASISG--FKRNPRAFWEFSMEM-KDKLFAEPNPAHYAIAE----LER----MGIVKAVITQNIDMLHQRAGS--RRVLELHGSMDKLDCLDCH--E-------------------TYDWSEFVED-------------------FNKGEI---PRC--RK--CG-----SYYVKPRVVLFGEPLPQR---TLFEAIEEAKHCDAFMVVGSSLVVYPAA-E-LP-YI----------AKKAGAKMIIVN---AEPTMADPIF-----DVKIIGKAGEVLPKIVEEVKR-----------------------------------
95 Fugue 85.7133% -94 - C4 -1ICI NPD1_ARCFU A:[1-256] ----------------------------------------------------------------------GSHHHHHHGSHMDEKLLKTIAESKYLVALTGAGVSAESGIPTFRGKDGLWNRY-------R-PEELANPQAFAKDPEKVWKWYAWRMEKVFNAQPNKAHQAFAE----LER----LGVLKCLITQNVDDLHERAGSR--NVIHLHGSLRVVRCTSCN--N-------------------S---FE-VES-------------------APKIPPL--PKC--DK--CG-----S-LLRPGVVWFGEMLPPDVLDRAMREVE--RA-DVIIVAGTS------A-V-VQ-PAASLP----LIVKQRGGAIIEIN---PDETPLTPIA-----DYSLRGKAGEVMDELVRHVRKALS--------------------------------
15 PsiBlast_PDB 85.4932%-102 - C4 -2NYR SIR5_HUMAN A:[7-271] --------------------------------------------------------------------------------SSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQ--DLA-TPLAFA-----HNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGK----QGRRVVVITQNIDELHRKAGT--KNLLEIHGSLFKTRCTSCG--VVAENYKSPICPALSGKGAPE---PGTQDA-------------------SIPVEKL--PRCEEAG--CG-----G-LLRPHVVWFGENLDPAILEEVDRELA--H-CDLCLVVGTS------SVV-YPAAMFAPQ----VAAR--GVPVAEFN---TE-------------RFHFQGPCGTTLPEALA---------------------------------------
12 PsiBlast_PDB 85.3132% -96 - C4 -3RIY SIR5_HUMAN A:[9-273] --------------------------------------------------------------------------------SSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQ--DLA-TPLAFA-----HNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGK----QGRRVVVITQNIDELHRKAGT--KNLLEIHGSLFKTRCTSCG--VVAENYKSPICPALSGKGAPE---PGTQDA-------------------SIPVEKL--PRCEEAG--CG-----G-LLRPHVVWFGENLDPAILEEVDRELA--H-CDLCLVVGTS------SVV-YPAAMFAPQ----VAAR--GVPVAEFN---TETTPATNRF-----RFHFQGPCGTTLPEALA---------------------------------------
8 PsiBlast_PDB 85.2436% -94 - C4 -1S7G NPD2_ARCFU A:[5-248] ----------------------------------------------------------------------------------IRKAAEILAKSKHAVVFTGAGISAESGIPTFRGEDGLWRKYDPE--EV----ASISG--FKRNPRAFWEFSMEM-KDKLFAEPNPAHYAIAE----LER----MGIVKAVITQNIDMLHQRAGS--RRVLELHGSMDKLDCLDCH--E-------------------TYDWSEFVED-------------------FNKGEI---PRC--RK--CG-----SYYVKPRVVLFGEPLPQR---TLFEAIEEAKHCDAFMVVGSSLVVYPAA-E-LP-YI----------AKKAGAKMIIVN---AEPTMADPIF-----DVKIIGKAGEVLPKIVEEVKR-----------------------------------
18 PsiBlast_PDB 85.2331% -99 - C4 -2B4Y SIR5_HUMAN A:[7-271] --------------------------------------------------------------------------------SSMADFRKFFAKAKHIVIISGAGVSAESGV-------GYWRKWQAQ--DLA-TPLAFA-----HNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGK----QGRRVVVITQNIDELHRKAGT--KNLLEIHGSLFKTRCTSCG--VVAENYKSPICPALSGKGAPE---PGTQDA-------------------SIPVEKL--PRCEEAG--CG-----G-LLRPHVVWFGENLDPAILEEVDRELA--H-CDLCLVVGTS------S-V-VY-PAAMFA----PQVAARGVPVAEFN---TETTPATNRF-----RFHFQGPCGTTLPEALA---------------------------------------
24 PsiBlast_CBE 85.2236% -93 - C4 -1YC2 NPD2_ARCFU D:[5-248] ----------------------------------------------------------------------------------IRKAAEILAKSKHAVVFTGAGISAESGIPTFRGEDGLWRKYDPE--EV----ASISG--FKRNPRAFWEFSMEM-KDKLFAEPNPAHYAIAE----LER----MGIVKAVITQNIDMLHQRAGS--RRVLELHGSMDKLDCLDCH--E-------------------TYDWSEFVED-------------------FNKGEI---PRC--RK--CG-----SYYVKPRVVLFGEPLPQR---TLFEAIEEAKHCDAFMVVGSSLVVYPAA-E-LP-YI----------AKKAGAKMIIVN---AEPTMADPIF-----DVKIIGKAGEVLPKIVEEVKR-----------------------------------
34 PsiBlast_CBE 85.1832% -98 - C4 -4G1C SIR5_HUMAN B:[3-267] --------------------------------------------------------------------------------SSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQ--DLA-TPLAFA-----HNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGK----QGRRVVVITQNIDELHRKAGT--KNLLEIHGSLFKTRCTSCG--VVAENYKSPICPALSGKGAPE---PGTQDA-------------------SIPVEKL--PRCEEAG--CG-----G-LLRPHVVWFGENLDPAILEEVDRELA--H-CDLCLVVGTS------SVV-YPAAMFAPQ----VAAR--GVPVAEFN---TETTPATNRF-----RFHFQGPCGTTLPEALA---------------------------------------
16 PsiBlast_PDB 84.9532% -95 - C4 -4G1C SIR5_HUMAN A:[3-267] --------------------------------------------------------------------------------SSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQ--DLA-TPLAFA-----HNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGK----QGRRVVVITQNIDELHRKAGT--KNLLEIHGSLFKTRCTSCG--VVAENYKSPICPALSGKGAPE---PGTQDA-------------------SIPVEKL--PRCEEAG--CG-----G-LLRPHVVWFGENLDPAILEEVDRELA--H-CDLCLVVGTS------SVV-YPAAMFAPQ----VAAR--GVPVAEFN---TETTPATNRF-----RFHFQGPCGTTLPEALA---------------------------------------
6 PsiBlast_PDB 82.5534% -88 - C4 -1M2J NPD1_ARCFU A:[7-242] ---------------------------------------------------------------------------------------KTIAESKYLVALTGAGVSAESGIPTFRGKDGLWNRYRPE--ELA-NPQAFA-----KDPEKVWKWYAWRMEKVFNAQPNKANQAFAE----LER----LGVLKCLITQNVDDLHERAGS--RNVIHLHGSLRVVRCTSC---------------------------NNSFEV-------------------ESAPKIPPLPKC--DK--CG-----S-LLRPGVVWFGEMLPPDVLDRAMREVE--RA-DVIIVAGTS------A-------VVQPAASLPLIVKQRGGAIIEIN---PDETPLTPIA-----DYSLRGKAGEVMDELVRHVRK-----------------------------------
38 PsiBlast_CBE 82.3332% -86 - C4 -4UUA SIR5_DANRE B:[11-271] --------------------------------------------------------------------------------SDLTAFREHFAKAKHIAIITGAGVSAESGVPTFRGPGGFWRKWQAQ--DLA-TPEAFS-----RDPSLVWEFYHYRREVMRSKMPNPAHLAIAECEARLGQ----QGRSVVIITQNIDELHHRAGS--KHVYEIHGSLFKTRCMSCG--EVKANHKSPICPALDGKGAPD---PNTKEA-------------------RIPVELL--PRCERKS--CN-----G-LLRPHVVWFGETLDSDILTAVERELE--KC-DLCLVVGTS------SIV-YPAAMFAPQ----VASR--GVPVAEFN---MECTPATQRF-----KYHFEGPCGSTLPPALE---------------------------------------
47 PsiBlast_CBE 82.2632% -92 - C4 -4UTX SIR5_DANRE A:[12-271] ---------------------------------------------------------------------------------DLTAFREHFAKAKHIAIITGAGVSAESGVPTFRGPGGFWRKWQAQ--DLA-TPEAFS-----RDPSLVWEFYHYRREVMRSKMPNPAHLAIAECEARLGQ----QGRSVVIITQNIDELHHRAGS--KHVYEIHGSLFKTRCMSCG--EVKANHKSPICPALDGKGAPD---PNTKEA-------------------RIPVELL--PRCERKS--CN-----G-LLRPHVVWFGETLDSDILTAVERELE--KC-DLCLVVGTS------SIV-YPAAMFAPQ----VASR--GVPVAEFN---MECTPATQ-------KYHFEGPCGSTLPPALE---------------------------------------