@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA1806: (2016-02-01 )
MGFLTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPELCFPCDVADDSQIEAVFAALGKHWDGLDIIVHSVGFAPGDQLDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSLGAEGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRNVTIEEVGNAGAFLCSDLASGISGEILYVDGGFNTTAMGPLDDD

Atome Classification :

(75 SA) ...-......10........20........30........40........50........60----------.........70...---------.....80........90........100---........110.......120.......130.......--140-.......150.......--160.......170.......180-.......190.......200.......210.......220---.......230.....-..240.......250.......260....---
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MGF-LTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPE-----------LCFPCDVADDSQIE---------AVFAALGKHWDGLDIIVHSVGFAPGDQ----LDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKG--RNG-SLLTLSYLGAERTMPNY--NVMGMAKASLEAGVRYLAGSLGA-EGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRN---VTIEEVGNAGAFLCS-DLASGISGEILYVDGGFNTTAMGP-LDDD---
21 PsiBlast_CBE 98.38100%-120 - C1 -4NR0 FABI_PSEAE D:[2-262] -GF-LTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPE-----------LCFPCDVADDSQIE---------AVFAALGKHWDGLDIIVHSVGFAPGDQ----LDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKG--RNG-SLLTLSYLGAERTMPNY--NVMGMAKASLEAGVRYLAGSLGA-EGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRN---VTIEEVGNAGAFLCS-DLASGISGEILYVDGGFNTTAMGP-L------
22 PsiBlast_CBE 97.58100%-118 - C1 -4NR0 FABI_PSEAE C:[2-262] -GF-LTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPE-----------LCFPCDVADDSQIE---------AVFAALGKHWDGLDIIVHSVGFAPGDQ----LDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKG--RNG-SLLTLSYLGAERTMPNY--NVMGMAKASLEAGVRYLAGSLGA-EGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRN---VTIEEVGNAGAFLCS-DLASGISGEILYVDGGFNTTAMGP-L------
2 PsiBlast_PDB 97.12100%-120 - C1 -4NR0 FABI_PSEAE A:[2-260] -GF-LTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPE-----------LCFPCDVADDSQIE---------AVFAALGKHWDGLDIIVHSVGFAPGDQ----LDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKG--RNG-SLLTLSYLGAERTMPNY--NVMGMAKASLEAGVRYLAGSLGA-EGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRN---VTIEEVGNAGAFLCS-DLASGISGEILYVDGGFNTTAMG---------
23 PsiBlast_CBE 96.26100%-119 - C1 -4NR0 FABI_PSEAE B:[2-260] -GF-LTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPE-----------LCFPCDVADDSQIE---------AVFAALGKHWDGLDIIVHSVGFAPGDQ----LDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKG--RNG-SLLTLSYLGAERTMPNY--NVMGMAKASLEAGVRYLAGSLGA-EGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRN---VTIEEVGNAGAFLCS-DLASGISGEILYVDGGFNTTAMG---------
1 PsiBlast_PDB 94.47100%-119 - C1 -4NQZ - FABI_PSEAE A:[2-259] -GF-LTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPE-----------LCFPCDVADDSQIE---------AVFAALGKHWDGLDIIVHSVGFAPGDQ----LDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKG--RNG-SLLTLSYLGAERTMPNY--NVMGMAKASLEAGVRYLAGSLGA-EGTRVNAVSAGPIRT----------KMLAANERQTPLRRN---VTIEEVGNAGAFLCS-DLASGISGEILYVDGGFNTTAM----------
3 PsiBlast_PDB 86.6170%-115 - C1 -4ZJU ? A:[12-270] -GL-LAGKRFLIAGVASKLSIAYGIAQALHREGAELAFTYPNEKLKKRVDEFAEQFGSK-------------LVFPCDVAVDAEID---------NAFAELAKHWDGVDGVVHSIGFAPAHT----LDGDFTDVTDRDGFKIAHDISAYSFVAMARAAKPLLQA--RQG-CLLTLTYQGSERVMPNY--NVMGMAKASLEAGVRYLASSLGV-DGIRVNAISAGPIRTLAASGIKSFRKMLDANEKVAPLKRN---VTIEEVGNAALFLCS-PWASGITGEILYVDAGFNTVGMSQS-------
35 PsiBlast_CBE 86.2469%-118 - C1 -1QSG FABI_ECOLI C:[5-262] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE-L------
28 PsiBlast_CBE 86.1169%-116 - C1 -1I2Z FABI_ECOLI B:[2-258] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
12 PsiBlast_PDB 85.7769%-119 - C1 -4JQC FABI_ECOLI A:[21-278] MGF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
4 PsiBlast_PDB 85.6769%-115 - C1 -1C14 FABI_ECOLI A:[2-257] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMN---------
37 PsiBlast_CBE 85.4469%-116 - C1 -1QG6 FABI_ECOLI D:[1-257] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
30 PsiBlast_CBE 85.3169%-119 - C1 -1QSG FABI_ECOLI H:[5-262] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE-L------
38 PsiBlast_CBE 85.2869%-116 - C1 -1QG6 FABI_ECOLI C:[1-257] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
36 PsiBlast_CBE 85.2869%-118 - C1 -1QSG FABI_ECOLI B:[5-262] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE-L------
11 PsiBlast_PDB 85.2869%-117 - C1 -1QSG FABI_ECOLI A:[5-262] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE-L------
98 PsiBlast_CBE 85.1762%-117 - C1 -4M87 ? A:[2-257] -GF-LQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAAELDS--E-----------LVFRCDVASDDEIN---------QVFADLGKHWDGLDGLVHSIGFAPKEA----LSGDFLDSISREAFNTAHEISAYSLPALAKAARPMMRG--RNS-AIVALSYLGAVRAIPNY--NVMGMAKASLEAGIRFTAACLGK-EGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRN---VTIEEVGNTAAFLLS-DLSSGITGEITYVDGGYSINALS---------
39 PsiBlast_CBE 85.0969%-116 - C1 -1QG6 FABI_ECOLI B:[1-257] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
13 PsiBlast_PDB 84.8269%-115 - C1 -4JX8 FABI_ECOLI A:[21-278] MGF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
32 PsiBlast_CBE 84.8069%-117 - C1 -1QSG FABI_ECOLI F:[5-262] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE-L------
29 PsiBlast_CBE 84.7069%-114 - C1 -1C14 FABI_ECOLI B:[2-257] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMN---------
9 PsiBlast_PDB 84.6469%-116 - C1 -1MFP FABI_ECOLI A:[2-259] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE-L------
17 PsiBlast_PDB 84.6069%-116 - C1 -1QG6 FABI_ECOLI A:[1-257] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
50 PsiBlast_CBE 84.5869%-116 - C1 -3PJD FABI_ECOLI B:[2-256] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIAFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
95 PsiBlast_CBE 84.3762%-115 - C1 -4M89 ? B:[2-257] -GF-LQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAAELDS--E-----------LVFRCDVASDDEIN---------QVFADLGKHWDGLDGLVHSIGFAPKEA----LSGDFLDSISREAFNTAHEISAYSLPALAKAARPMMRG--RNS-AIVALSYLGAVRAIPNY--NVMGMAKASLEAGIRFTAACLGK-EGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRN---VTIEEVGNTAAFLLS-DLSSGITGEITYVDGGYSINALS---------
25 PsiBlast_CBE 84.2569%-117 - C1 -1LXC FABI_ECOLI B:[2-259] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTL-------FRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE-L------
45 PsiBlast_CBE 84.0069%-116 - C1 -1D8A FABI_ECOLI B:[1-257] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
15 PsiBlast_PDB 83.9069%-112 - C1 -1DFH FABI_ECOLI A:[1-257] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
24 PsiBlast_CBE 83.8869%-116 - C1 -1MFP FABI_ECOLI B:[2-259] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE-L------
52 PsiBlast_CBE 83.8169%-116 - C1 -3PJE FABI_ECOLI B:[2-256] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSISFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
43 PsiBlast_CBE 83.7269%-112 - C1 -1DFH FABI_ECOLI B:[1-257] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
46 PsiBlast_CBE 83.7069%-116 - C1 -4D46 ? B:[2-256] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDF------CEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAM----------
56 PsiBlast_CBE 83.4665%-115 - C1 -4BKU ? A:[2-257] -GF-LDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGS--E-----------LVFPCDVADDAQID---------ALFASLKTHWDSLDGLVHSIGFAPREA----IAGDFLDGLTRENFRIAHDISAYSFPALAKAALPMLSD---DA-SLLTLSYLGAERAIPNY--NTMGLAKAALEASVRYLAVSLGA-KGVRVNAISAGPIKTLAASGIKSFGKILDFVESNSPLKRN---VTIEQVGNAGAFLLS-DLASGVTAEVMHVDSGFNAVVGGM--------
96 PsiBlast_CBE 83.2962%-116 * C1 *4M89 ? A:[2-257] -GF-LQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAAELDS--E-----------LVFRCDVASDDEIN---------QVFADLGKHWDGLDGLVHSIGFAPKEA----LSGDFLDSISREAFNTAHEISAYSLPALAKAARPMMRG--RNS-AIVALSYLGAVRAIPNY--NVMGMAKASLEAGIRFTAACLGK-EGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRN---VTIEEVGNTAAFLLS-DLSSGITGEITYVDGGYSINALS---------
5 PsiBlast_PDB 83.0269%-117 - C1 -1I2Z FABI_ECOLI A:[2-258] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
20 PsiBlast_PDB 82.7869%-118 - C1 -4CV3 ? A:[2-256] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPI-----------------CEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMN---------
53 PsiBlast_CBE 82.7469%-114 - C1 -3PJE FABI_ECOLI A:[2-256] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSISFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
49 PsiBlast_CBE 82.7069%-119 - C1 -4CV2 ? B:[2-256] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPI------------------EAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMN---------
41 PsiBlast_CBE 82.6969%-117 - C1 -1DFI FABI_ECOLI C:[1-257] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTL----------MLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
44 PsiBlast_CBE 82.5269%-113 - C1 -1DFG FABI_ECOLI B:[1-257] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIGFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------
54 PsiBlast_CBE 82.4869%-116 - C1 -3PJF FABI_ECOLI B:[2-256] -GF-LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGS--D-----------IVLQCDVAEDASID---------TMFAELGKVWPKFDGFVHSIVFAPGDQ----LDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN---PGS-ALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIAAMNE--------