@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA2025: (2016-02-03 )
MSFDFDLFVIGAGSGGVRAARFAAGFGARVAVAESRYLGGTCVNVGCVPKKLLVYGAHFSEDFEQARAYGWSAGEAQFDWATLIGNKNREIQRLNGIYRNLLVNSGVTLLEGHARLLDAHSVEVDGQRFSAKHILVATGGWPQVPDIPGKEHAITSNEAFFLERLPRRVLVVGGGYIAVEFASIFNGLGAETTLLYRRDLFLRGFDRSVREHLRDELGKKGLDLQFNSDIARIDKQADGSLAATLKDGRVLEADCVFYATGRRPMLDDLGLENTAVKLTDKGFIAVDEHYQTSEPSILALGDVIGRVQLTPVALAEGMAVARRLFKPEEYRPVDYKLIPTAVFSLPNIGTVGLTEEEALSAGHKVKIFESRFRPMKLTLTDDQEKTLMKLVVDAHDDRVLGCHMVGAEAGEILQGIAVAMKAGATKQAFDETIGIHPTAAEEFVTLRTPTR

Atome Classification :

(75 SA) --------------------------------------------------------------------------------------------------.........10........20...-.-.-...30..---------...---------.---------..40........50........60...-.-....70.--.--.--....--.80........90........100....-....110......--.120...--.-----.---------.---------...130.......140....---.-...-150-........160.......170.......180.....---.---.---190.......200.......210.......220.......230....--------...-240.---...----..------.------250-..-......260.......270.......280.......290.......300..-.----....310.......320...--....330.......340.......350.......360.--.--.-.-----.-....370.......380--.-.-......-.390-...-..-..400.......410.......420.......430.......440.......450------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) --------------------------------------------------------------------------------------------------MSFDFDLFVIGAGSGGVRAARFAA-G-F-GARVAVA---------ESR---------Y---------LGGTCVNVGCVPKKLLVYGAHFSEDFE-Q-ARAYGWS--A--G--EAQF--DWATLIGNKNREIQRLNGIYRNL-LVNS-GVTLLEGHARLLD--AH--SVE--V-----D---------G---------QRFSAKHILVATGG-WPQVP---D-IPG-KE--HAITSNEAFFLERLPRRVLVVGGGYIAVEFASIFNG---L---G---AETTLLYRRDLFLRGFDRSVREHLRDELGKKGLDLQFNSDIARIDKQ--------ADG-SLAA---TLK----DG------R------V-L-EA-DCVFYATGRRPMLDDLGLENTAVKLTDKGFIAVDEHYQTSEPSILALGDVI-G----RVQLTPVALAEGMAVARRLF--KPEEYRPVDYKLIPTAVFSLPNIGTVGLTEEEALS--A--G--H-K-----V-KIFESRFRPMKLTLT----D-D-QEKTLM-KLVV-DAH-DD-RVLGCHMVGAEAGEILQGIAVAMKAGATKQAFDETIGIHPTAAEEFVTLRTPTR-------
1 PsiBlast_PDB 97.0046%-109 - C1 -3O0H ? A:[24-473] ---------------------------------------------------------------------------------------------------SFDFDLFVIGSGSGGVRAARLAG-A-L-GKRVAIA---------EEY---------R---------IGGTCVIRGCVPKKLYFYASQYAQEFS-K-SIGFGWK--Y--A--DPIF--NWEKLVAAKNKEISRLEGLYREG-LQNS-NVHIYESRAVFVD--EH--TLELSV-----T---------G---------ERISAEKILIATGAKIVSN------IKG-SD--LCLTSNEIFDLEKLPKSIVIVGGGYIGVEFANIFHG---L---G---VKTTLLHRGDLILRNFDYDLRQLLNDAMVAKGISIIYEATVSQV-QS--------TEN-CYNV---VLT----NG------Q------T-I-CA-DRVMLATGRVPNTTGLGLERAGVKVNEFGAVVVDEKMTTNVSHIWAVGDVT-G----HIQLTPVAIHDAMCFVKNAF--E---TTP-DYDLITTAVFSQPEIGTVGLSEEDALH--R--Y--K-R-----V-EIYRTVFRPMRNVLS----G-S-PEKMFM-KLVV-DGE-SR-IVVGAHVLGENAGEIAQLIGISLKGKLTKDIFDKTMAVHPTMSEELVTMYKPSY-------
112 HHSearch 96.9647%-108 - C1 -3O0H ? A:[24-472] ---------------------------------------------------------------------------------------------------SFDFDLFVIGSGSGGVRAARLAG-A-L-GKRVAIA---------EEY---------R---------IGGTCVIRGCVPKKLYFYASQYAQEFS-K-SIGFGWK--Y--A--DPIF--NWEKLVAAKNKEISRLEGLYREG-LQNS-NVHIYESRAVFVD--EH--TLE--L-----SVT-------G---------ERISAEKILIATGA-KIVSN-----IKG-SD--LCLTSNEIFDLEKLPKSIVIVGGGYIGVEFANIFHG---L---G---VKTTLLHRGDLILRNFDYDLRQLLNDAMVAKGISIIYEATVSQVQST--------ENC--YNV---VLT----NG------Q------T-I-CA-DRVMLATGRVPNTTGLGLERAGVKVNEFGAVVVDEKMTTNVSHIWAVGDVT-G----HIQLTPVAIHDAMCFVKNAF--E----TTPDYDLITTAVFSQPEIGTVGLSEEDALH--R--Y--K-R-----V-EIYRTVFRPMRNVLS----G-S-PEKMFM-KLVV-DGE-SR-IVVGAHVLGENAGEIAQLIGISLKGKLTKDIFDKTMAVHPTMSEELVTMYKPSY-------
126 HHSearch 90.8545%-104 - C1 -3DK9 GSHR_HUMAN A:[18-478] ---------------------------------------------------------------------------------------------------VASYDYLVIGGGSGGLASARRAA-E-L-GARAAVV---------ESH---------K---------LGGTCVNVGCVPKKVMWNTAVHSEFMH-D-HADYGFP--S--C--EGKF--NWRVIKEKRDAYVSRLNAIYQNN-LTKS-HIEIIRGHAAFTS--DPKPTIE--V-----S---------G---------KKYTAPHILIATGG-MPSTPHESQ-IPG-AS--LGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSA---L---G---SKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKT--------LSG--LEVSMVTAV----PGRLPVMTM------I-P-DV-DCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVC-G----KALLTPVAIAAGRKLAHRLF--EYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIH--KY-G--IEN-----V-KTYSTSFTPMYHAVT----K-R-KTKCVM-KMVC-ANK-EE-KVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR-----------
83 PsiBlast_CBE 90.7641%-103 - C1 -2X50 ? A:[22-494] ---------------------------------------------------------------------------------------------------SRAYDLVVLGAGSGGLEAGWNAAVT-H-KKKVAVV---------DVQ---------ATHGPPLFAALGGTCVNVGCVPKKLMVTGAQYMDLIR-E-SGGFGWE--M--D--RESLCPNWKTLIAAKNKVVNSINESYKSM-FADTEGLSFHMGFGALQD--AH--TVV--V-----R---------KSEDPHSDVLETLDTEYILIATGS-WPTRL---G-VPG-DE--FCITSNEAFYLEDAPKRMLCVGGGYIAVEFAGIFNGYKPC---G---GYVDLCYRGDLILRGFDTEVRKSLTKQLGANGIRVRTNLNPTKITKN--------EDG-SNHV---HFN----DG------T------E-E-DY-DQVMLAIGRVPRSQALQLDKAGVRTGKNGAVQVDAYSKTSVDNIYAIGDVT-N----RVMLTPVAINEGAAFVETVFGGKP---RATDHTKVACAVFSIPPIGTCGMTEEEAAK--N--Y--E-T-----V-AVYASSFTPLMHNIS----G-S-KHKEFMIRIIT-NES-NG-EVLGVHMLGDSAPEIIQSVGICMKMGAKISDFHSTIGVHPTSAEELCSMRTPAY-------
69 PsiBlast_CBE 90.3643%-107 - C1 -1GRA GSHR_HUMAN A:[20-478] -----------------------------------------------------------------------------------------------------SYDYLVIGGGSGGLASARRAA-E-L-GARAAVV---------ESH---------K---------LGGTCVNVGCVPKKVMWNTAVHSEFMH-D-HADYGFP--S--C--EGKF--NWRVIKEKRDAYVSRLNAIYQNN-LTKS-HIEIIRGHAAFTSDPKP--TIE--V-----S---------G---------KKYTAPHILIATGG-MPSTPHESQ-IPG-AS--LGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSA---L---G---SKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKT--------LSG-LEVSMV-TAV----PG------RLPVMTMI-P-DV-DCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVC-G----KALLTPVAIAAGRKLAHRLF--EYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAI---------H-KYGIENV-KTYSTSFTPMYHAVT----K-R-KTKCVM-KMVC-ANK-EE-KVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR-----------
111 HHSearch 90.3344%-104 - C1 -1GES GSHR_ECOLI A:[3-450] ----------------------------------------------------------------------------------------------------KHYDYIAIGGGSGGIASINRAA-M-Y-GQKCALI---------EAK---------E---------LGGTCVNVGCVPKKVMWHAAQIREAIH-MYGPDYGFD--T--T--INKF--NWETLIASRTAYIDRIHTSYENV-LGKN-NVDVIKGFARFVD--AK--TLE--V-----N---------G---------ETITADHILIATGG-RPSHP---D-IPG-VE--YGIDSDGFFALPALPERVAVVGAGYIGVELGGVING---L---G---AKTHLFEMFDAPLPSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKN--------TDG-SLTL---ELE----DG------R------S-E-TV-DCLIWAIGREPANDNINLEAAGVKTNEKGYIVVDKYQNTNIEGIYAVGDNT-G----AVELTPVAVAAGRRLSERLF--NNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQARE--Q--YGDD-Q-----V-KVYKSSFTAMYTAVT----T-H-RQPCRM-KLVC-VGS-EE-KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTAAEEFVTMR-----------
72 PsiBlast_CBE 90.1441% -99 - C1 -4APN ? B:[21-494] --------------------------------------------------------------------------------------------------MSRAYDLVVLGAGSGGLEAGWNAAVT-H-KKKVAVV---------DVQ---------ATHGPPLFAALGGTCVNVGCVPKKLMVTGAQYMDLIR-E-SGGFGWE--M--D--RESLCPNWKTLIAAKNKVVNSINESYKSM-FADTEGLSFHMGFGALQD--AH--TVV--V-----R---------KSEDPHSDVLETLDTEYILIATGS-WPTRL---G-VPG-DE--FCITSNEAFYLEDAPKRMLCVGGGYIAVEFAGIFNGYKPC---G---GYVDLCYRGDLILRGFDTEVRKSLTKQLGANGIRVRTNLNPTKITKN--------EDG-SNHV---HFN----DG------T------E-E-DY-DQVMLAIGRVPRSQALQLDKAGVRTGKNGAVQVDAYSKTSVDNIYAIGDVT-N----RVMLTPVAINEGAAFVETVFGGKP---RATDHTKVACAVFSIPPIGTCGMTEEEAAK--N--Y--E-T-----V-AVYASSFTPLMHNIS----G-S-KHKEFMIRIIT-NES-NG-EVLGVHMLGDSAPEIIQSVGICMKMGAKISDFHSTIGVHPTSAEELCSMRTPAY-------
70 PsiBlast_CBE 90.0343%-106 - C1 -1BWC GSHR_HUMAN A:[20-478] -----------------------------------------------------------------------------------------------------SYDYLVIGGGSGGLASARRAA-E-L-GARAAVV---------ESH---------K---------LGGTCVNVGCVPKKVMWNTAVHSEFMH-D-HADYGFP--S--C--EGKF--NWRVIKEKRDAYVSRLNAIYQNN-LTKS-HIEIIRGHAAFTSDPKP--TIE--V-----S---------G---------KKYTAPHILIATGG-MPSTPHESQ-IPG-AS--LGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSA---L---G---SKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKT--------LSG-LEVSMV-TAV----PG------RLPVMTMI-P-DV-DCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVC-G----KALLTPVAIAAGRKLAHRLF--EYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAI---------H-KYGIENV-KTYSTSFTPMYHAVT----K-R-KTKCVM-KMVC-ANK-EE-KVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR-----------
79 PsiBlast_CBE 89.7341%-102 - C1 -2W0H ? A:[22-494] ---------------------------------------------------------------------------------------------------SRAYDLVVLGAGSGGLEAGWNAAVT-H-KKKVAVV---------DVQ---------ATHGPPLFAALGGTCVNVGCVPKKLMVTGAQYMDLIR-E-SGGFGWE--M--D--RESLCPNWKTLIAAKNKVVNSINESYKSM-FADTEGLSFHMGFGALQD--AH--TVV--V-----R---------KSEDPHSDVLETLDTEYILIATGS-WPTRL---G-VPG-DE--FCITSNEAFYLEDAPKRMLCVGGGYIAVEFAGIFNGYKPC---G---GYVDLCYRGDLILRGFDTEVRKSLTKQLGANGIRVRTNLNPTKITKN--------EDG-SNHV---HFN----DG------T------E-E-DY-DQVMLAIGRVPRSQALQLDKAGVRTGKNGAVQVDAYSKTSVDNIYAIGDVT-N----RVMLTPVAINEGAAFVETVFGGKP---RATDHTKVACAVFSIPPIGTCGMTEEEAAK--N--Y--E-T-----V-AVYASSFTPLMHNIS----G-S-KHKEFMIRIIT-NES-NG-EVLGVHMLGDSAPEIIQSVGICMKMGAKISDFHSTIGVHPTSAEELCSMRTPAY-------
71 PsiBlast_CBE 89.6643%-104 - C1 -1XAN GSHR_HUMAN A:[3-461] -----------------------------------------------------------------------------------------------------SYDYLVIGGGSGGLASARRAA-E-L-GARAAVV---------ESH---------K---------LGGTCVNVGCVPKKVMWNTAVHSEFMH-D-HADYGFP--S--C--EGKF--NWRVIKEKRDAYVSRLNAIYQNN-LTKS-HIEIIRGHAAFTSDPKP--TIE--V-----S---------G---------KKYTAPHILIATGG-MPSTPHESQ-IPG-AS--LGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSA---L---G---SKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKT--------LSG-LEVSMV-TAV----PG------RLPVMTMI-P-DV-DCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVC-G----KALLTPVAIAAGRKLAHRLF--EYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAI---------H-KYGIENV-KTYSTSFTPMYHAVT----K-R-KTKCVM-KMVC-ANK-EE-KVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR-----------
61 PsiBlast_CBE 89.5643%-106 - C1 -3DK4 GSHR_HUMAN A:[20-478] -----------------------------------------------------------------------------------------------------SYDYLVIGGGSGGLASARRAA-E-L-GARAAVV---------ESH---------K---------LGGTCVNVGCVPKKVMWNTAVHSEFMH-D-HADYGFP--S--C--EGKF--NWRVIKEKRDAYVSRLNAIYQNN-LTKS-HIEIIRGHAAFTSDPKP--TIE--V-----S---------G---------KKYTAPHILIATGG-MPSTPHESQ-IPG-AS--LGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSA---L---G---SKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKT--------LSG-LEVSMV-TAV----PG------RLPVMTMI-P-DV-DCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVC-G----KALLTPVAIAAGRKLAHRLF--EYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAI---------H-KYGIENV-KTYSTSFTPMYHAVT----K-R-KTKCVM-KMVC-ANK-EE-KVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR-----------
41 PsiBlast_CBE 89.5442%-106 - C1 -2WOW ? C:[4-478] --------------------------------------------------------------------------------------------------MSKAFDLVVIGAGSGGLEAGWNAA-TLY-GKRVAVV---------DVQ---------TSHGPPFYAALGGTCVNVGCVPKKLMVTGAQYMDHLR-E-SAGFGWEFDG--S--SVKA--NWKKLIAAKNEAVLDINKSYEGM-FNDTEGLDFFLGWGSLES--KN--VVV--V-----RETADPKSAVK---------ERLQADHILLATGS-WPQMP---A-IPG-IE--HCISSNEAFYLPEPPRRVLTVGGGFISVEFAGIFNA---YKPPG---GKVTLCYRNNLILRGFDETIREEVTKQLTANGIEIMTNENPAKVSLN--------TDG-SKHV---TFE----SG------K------T-L-DV-DVVMMAIGRIPRTNDLQLGNVGVKLTPKGGVQVDEFSRTNVPNIYAIGDIT-D----RLMLTPVAINEGAALVDTVFGNKP---RKTDHTRVASAVFSIPPIGTCGLIEEVAAK--E--F--E-K-----V-AVYMSSFTPLMHNIS----G-S-KYKKFV-AKIV-TNH-SDGTVLGVHLLGDGAPEIIQAVGVCLRLNAKISDFYNTIGVHPTSAEELCSMRTPSY-------
59 PsiBlast_CBE 89.4343%-104 - C1 -3DK9 GSHR_HUMAN A:[20-478] -----------------------------------------------------------------------------------------------------SYDYLVIGGGSGGLASARRAA-E-L-GARAAVV---------ESH---------K---------LGGTCVNVGCVPKKVMWNTAVHSEFMH-D-HADYGFP--S--C--EGKF--NWRVIKEKRDAYVSRLNAIYQNN-LTKS-HIEIIRGHAAFTSDPKP--TIE--V-----S---------G---------KKYTAPHILIATGG-MPSTPHESQ-IPG-AS--LGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSA---L---G---SKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKT--------LSG-LEVSMV-TAV----PG------RLPVMTMI-P-DV-DCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVC-G----KALLTPVAIAAGRKLAHRLF--EYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAI---------H-KYGIENV-KTYSTSFTPMYHAVT----K-R-KTKCVM-KMVC-ANK-EE-KVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR-----------
67 PsiBlast_CBE 89.4143%-104 - C1 -1GRE GSHR_HUMAN A:[20-478] -----------------------------------------------------------------------------------------------------SYDYLVIGGGSGGLASARRAA-E-L-GARAAVV---------ESH---------K---------LGGTCVNVGCVPKKVMWNTAVHSEFMH-D-HADYGFP--S--C--EGKF--NWRVIKEKRDAYVSRLNAIYQNN-LTKS-HIEIIRGHAAFTSDPKP--TIE--V-----S---------G---------KKYTAPHILIATGG-MPSTPHESQ-IPG-AS--LGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSA---L---G---SKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKT--------LSG-LEVSMV-TAV----PG------RLPVMTMI-P-DV-DCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVC-G----KALLTPVAIAAGRKLAHRLF--EYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAI---------H-KYGIENV-KTYSTSFTPMYHAVT----K-R-KTKCVM-KMVC-ANK-EE-KVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR-----------
8 PsiBlast_PDB 89.2142%-106 - C1 -2WOW ? A:[4-478] --------------------------------------------------------------------------------------------------MSKAFDLVVIGAGSGGLEAGWNAA-TLY-GKRVAVV---------DVQ---------TSHGPPFYAALGGTCVNVGCVPKKLMVTGAQYMDHLR-E-SAGFGWEFDG--S--SVKA--NWKKLIAAKNEAVLDINKSYEGM-FNDTEGLDFFLGWGSLES--KN--VVV--V-----RETADPKSAVK---------ERLQADHILLATGS-WPQMP---A-IPG-IE--HCISSNEAF