@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA2748: (2016-02-10 )
MIKSAEEIQRMSVAGALTAKVLEALDEVVRPGISTAEIDRFCERYIVDTLAAIPGSKGQYGYPFTVNTSVNEVVCHGWPSAQQILRDGDIVNVDVTVIKDGYFGDSSKMYRVGAIDRQAQKLLDVTRECLYRAIRVVRPDATLGDIGHAIQSHAEANGYSVVREYCGHGIGRKMHEAPQVLHFGRAGAGARLKAGMTFTIEPMINQGGHAVKLHKDGWTVTTRDRRLSAQYEHTVLVTERGCRVLTLRDEEREALADLAG

Atome Classification :

(87 SA) .........10........20........30........40........50...-.....60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210-...-....220.......230.......240.......250.......260
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MIKSAEEIQRMSVAGALTAKVLEALDEVVRPGISTAEIDRFCERYIVDTLAAIP-GSKGQYGYPFTVNTSVNEVVCHGWPSAQQILRDGDIVNVDVTVIKDGYFGDSSKMYRVGAIDRQAQKLLDVTRECLYRAIRVVRPDATLGDIGHAIQSHAEANGYSVVREYCGHGIGRKMHEAPQVLHFGRAGAGARLKAGMTFTIEPMINQGGHAVK-LHK-DGWTVTTRDRRLSAQYEHTVLVTERGCRVLTLRDEEREALADLAG
26 PsiBlast_CBE 95.0357% -96 - C2 -4FO7 ? B:[5-253] -IKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIP-APLNYKGFPKSICTSINHVVCHGIPN-EKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETR-LLG-DGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDE---------
19 PsiBlast_PDB 94.8155% -93 - C2 -2GG0 MAP1_ECOLI A:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
54 PsiBlast_CBE 94.5854% -92 - C2 -2MAT MAP1_ECOLI A:[5-254] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
57 PsiBlast_CBE 94.2154% -93 - C2 -1C24 MAP1_ECOLI A:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
23 PsiBlast_CBE 94.1957% -95 - C2 -4FO8 ? B:[5-253] -IKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIP-APLNYKGFPKSICTSINHVVCHGIPN-EKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETR-LLG-DGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDE---------
59 PsiBlast_CBE 94.0754% -93 - C2 -1C22 MAP1_ECOLI A:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
14 PsiBlast_PDB 93.9255% -93 - C2 -2GU7 MAP1_ECOLI A:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
20 PsiBlast_PDB 93.8755% -90 - C2 -2GG2 MAP1_ECOLI A:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
41 PsiBlast_CBE 93.8255% -89 - C2 -2GG9 MAP1_ECOLI A:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
40 PsiBlast_CBE 93.7955% -90 - C2 -2GGB MAP1_ECOLI A:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
13 PsiBlast_PDB 93.7855% -91 - C2 -2GU6 MAP1_ECOLI A:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
34 PsiBlast_CBE 93.7455% -91 - C2 -2GU5 MAP1_ECOLI B:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
49 PsiBlast_CBE 93.6955% -92 - C2 -2GTX MAP1_ECOLI A:[2-251] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
21 PsiBlast_CBE 93.6657% -94 - C2 -4FO8 ? D:[5-253] -IKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIP-APLNYKGFPKSICTSINHVVCHGIPN-EKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETR-LLG-DGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDE---------
60 PsiBlast_CBE 93.6454% -91 - C2 -1C21 MAP1_ECOLI A:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
47 PsiBlast_CBE 93.5455% -92 - C2 -3D27 MAP1_ECOLI A:[2-251] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
29 PsiBlast_CBE 93.5357% -95 - C2 -4JUQ ? B:[5-253] -IKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIP-APLNYKGFPKSICTSINHVVCHGIPN-EKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETR-LLG-DGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDE---------
42 PsiBlast_CBE 93.4555% -89 - C2 -2GG8 MAP1_ECOLI A:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
3 PsiBlast_PDB 93.4257% -91 - C2 -4JUQ ? A:[5-253] -IKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIP-APLNYKGFPKSICTSINHVVCHGIPN-EKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETR-LLG-DGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDE---------
35 PsiBlast_CBE 93.3855% -92 - C2 -2GU4 MAP1_ECOLI B:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
31 PsiBlast_CBE 93.3655% -90 - C2 -2EVO MAP1_ECOLI B:[5-254] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
5 PsiBlast_PDB 93.3155% -93 - C2 -2BB7 MAP1_ECOLI A:[5-254] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
8 PsiBlast_PDB 93.3055% -90 - C2 -2EVO MAP1_ECOLI A:[5-254] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
48 PsiBlast_CBE 93.2355% -92 - C2 -2GTX MAP1_ECOLI B:[2-251] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
11 PsiBlast_PDB 93.2355% -92 - C2 -2GU4 MAP1_ECOLI A:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
44 PsiBlast_CBE 93.1755% -91 - C2 -2GG5 MAP1_ECOLI A:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
36 PsiBlast_CBE 93.1355% -92 - C2 -2Q96 MAP1_ECOLI A:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------
37 PsiBlast_CBE 93.0555% -93 - C2 -2Q95 MAP1_ECOLI A:[4-253] -IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVS-ACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIR-TMK-DGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDD---------