@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA3361: (2016-02-16 )
MATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG

Atome Classification :

(91 SA) .........10........20........30.....--...40........50........60........70........80....------....90........100.......110...
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
60 PsiBlast_CBE 97.22100%-107 - C9 -4CE8 ? B:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
91 PsiBlast_CBE 97.08100%-110 - C9 -1OUS ? B:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
21 PsiBlast_CBE 97.00100%-107 - C9 -3ZDV ? D:[2-115] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
28 PsiBlast_CBE 96.97100%-106 - C9 -2JDH ? C:[2-115] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
75 PsiBlast_CBE 96.86100%-106 - C9 -2BP6 ? B:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
77 PsiBlast_CBE 96.85100%-107 - C9 -2BOJ ? C:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
37 PsiBlast_CBE 96.80100%-107 - C9 -1GZT ? C:[2-115] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
79 PsiBlast_CBE 96.78100%-107 - C9 -1UZV ? D:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
19 PsiBlast_PDB 96.76100%-103 - C9 -2BOJ ? A:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
2 PsiBlast_PDB 96.73100%-107 - C9 -1W8F ? A:[2-115] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
80 PsiBlast_CBE 96.65100%-106 - C9 -1UZV ? C:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
30 PsiBlast_CBE 96.56100%-106 - C9 -1W8H ? D:[2-115] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
70 PsiBlast_CBE 96.55100%-106 - C9 -2VUC ? C:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
46 PsiBlast_CBE 96.5299%-107 - C9 -2JDM ? C:[2-115] -ATQGVFTLPANTRFGVTAFANASGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
84 PsiBlast_CBE 96.46100%-106 - C9 -1OXC ? B:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
22 PsiBlast_CBE 96.41100%-108 - C9 -3ZDV ? C:[2-115] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
74 PsiBlast_CBE 96.33100%-108 - C9 -2BP6 ? C:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
32 PsiBlast_CBE 96.28100%-105 - C9 -1W8H ? B:[2-115] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
86 PsiBlast_CBE 96.25100%-105 - C9 -1OVS ? C:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
43 PsiBlast_CBE 96.2599%-107 - C9 -2JDN ? C:[2-115] -ATQGVFTLPANTRFGVTAFANASGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
24 PsiBlast_CBE 96.17100%-108 - C9 -2JDK ? D:[2-115] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
34 PsiBlast_CBE 96.16100%-107 - C9 -1W8F ? C:[2-115] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
57 PsiBlast_CBE 96.15100%-105 - C9 -5A3O ? A:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
33 PsiBlast_CBE 96.12100%-108 - C9 -1W8F ? D:[2-115] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
73 PsiBlast_CBE 96.07100%-104 - C9 -2BP6 ? D:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
64 PsiBlast_CBE 96.07100%-107 - C9 -3DCQ ? A:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
9 PsiBlast_PDB 96.0399%-105 - C9 -2JDP ? A:[2-115] -ATQGVFTLPANTRFGVTAFANSAGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
68 PsiBlast_CBE 95.98100%-108 - C9 -2VUD ? A:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
66 PsiBlast_CBE 95.95100%-108 - C9 -2VUD ? C:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
63 PsiBlast_CBE 95.94100%-102 - C9 -3DCQ ? B:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
6 PsiBlast_PDB 95.92100%-109 - C9 -3ZDV ? A:[2-115] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
3 PsiBlast_PDB 95.91100%-101 - C9 -1W8H ? A:[2-115] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
25 PsiBlast_CBE 95.88100%-105 - C9 -2JDK ? C:[2-115] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
56 PsiBlast_CBE 95.86100%-105 - C9 -5A3O ? B:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
17 PsiBlast_PDB 95.77100%-104 - C9 -1OXC ? A:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
87 PsiBlast_CBE 95.76100%-102 * C9 *1OVS ? B:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
54 PsiBlast_CBE 95.73100%-108 - C9 -5A3O ? D:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
59 PsiBlast_CBE 95.67100%-106 - C9 -4CE8 ? C:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------N-LNFALVGSEDGTDNDYNDAVVVINWPLG
83 PsiBlast_CBE 95.61100%-108 - C9 -1OXC ? C:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
51 PsiBlast_CBE 95.6199%-108 - C9 -2JDU ? D:[2-115] -ATQGVFTLPANTRFGVTAFANSSNTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
93 PsiBlast_CBE 95.6090%-101 - C9 -4UT5 ? C:[1-114] -ATQGVFTLPANTRFGVTAFANSSATQTVKVLVNNE--TAATFTGQSTNNAVIGSQVLNSGGGGKVQIQVSVNGRSSDLVSAQVILA------NELNVALVGSEDSTDNDYNDAVVVINWPLG
65 PsiBlast_CBE 95.53100%-105 - C9 -2VUD ? D:[1-114] -ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNE--TAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILT------NELNFALVGSEDGTDNDYNDAVVVINWPLG
92 PsiBlast_CBE 95.4790%-104 - C9 -4UT5 ? D:[1-114] -ATQGVFTLPANTRFGVTAFANSSATQTVKVLVNNE--TAATFTGQSTNNAVIGSQVLNSGGGGKVQIQVSVNG