@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA3650: (2016-02-19 )
MSRPQRISVLGATGSIGLSTLDVVQRHPDRYEAFALTGFSRLAELEALCLRHRPVYAVVPEQAAAIALQGSLAAAGIRTRVLFGEQALCEVASAPEVDMVMAAIVGAAGLPSTLAAVEAGKRVLLANKEALVMSGALFMQAVKRSGAVLLPIDSEHNAIFQSLPRNYADGLERVGVRRILLTASGGPFRETPLEQLASVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAQPSQVEVVIHPQSVIHSMVDYVDGSVIAQLGNPDMRTPISYAMAWPERIDSGVSPLDMFAVGRLDFQRPDEQRFPCLRLASQAAETGGSAPAMLNAANEVAVAAFLERHIRFSDIAVIIEDVLNREAVTAVESLDQVLAADRRARSVAGQWLTRHAG

Atome Classification :

(72 SA) .........10........20...---.....30........40....---------....50........60........70.......-.80........90........100.......110.......120.......130.......140.-......150.......160...------..--.-------.--170---.....-....180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350.......360---......--.-370-........380.......390....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSRPQRISVLGATGSIGLSTLDVV---QRHPDRYEAFALTGFSRLAEL---------EALCLRHRPVYAVVPEQAAAIALQGSLAAAGIR-TRVLFGEQALCEVASAPEVDMVMAAIVGAAGLPSTLAAVEAGKRVLLANKEALVMSGALFMQAVK-RSGAVLLPIDSEHNAIFQSLPR------NY--A-------D--G-----LERVG-VRRILLTASGGPFRETPLEQLASVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAQPSQVEVVIHPQSVIHSMVDYVDGSVIAQLGNPDMRTPISYAMAWPERIDSGVSPLDMFAVGRLDFQRPDEQRFPCLRLASQAAETGGSAPAMLNAANEVAVAAFLERHIRFSDIAVIIEDVL---NREAVT--A-VE--SLDQVLAADRRARSVAGQWLTRHAG
10 PsiBlast_PDB 97.2657%-115 - C1 -3R0I DXR_ECOLI A:[14-409] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQAC-----SMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
15 PsiBlast_PDB 97.1357%-117 - C1 -3IIE DXR_YERPY A:[5-398] ----KQLTILGSTGSIGNSTLSVV---RANPELFKVTALVAGRNVREM---------AQQCLEFSPRYAAMSDEHSAKSLRLLLAEQGSD-TEVYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVK-RSRAQLLPIDSEHNAIFQSLPE------RI--QRQLGY--S--S-----LNENG-VSRIILTGSGGPFRETPLSQFSDVTPDQA---------RKISVDSATMMNKGLEYIEARWLFNASAEQIEVVLHPQSVIHSMVRYHDGSILAQMGTPDMRTPIAHAMAYPMRVSSGVAPLDFCKVGALTFTTPDYQRYPCLKLAIDACNAGQAATTALNAANEISVMAFLDSKIRFTDIEVINRTVV---EGLLLS--E-PT--SVEEVLVIDRKARDVAAQVIAK---
4 PsiBlast_PDB 97.0657%-111 - C1 -1T1R DXR_ECOLI A:[2-397] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
32 PsiBlast_CBE 96.7257%-119 - C1 -3IIE DXR_YERPY B:[5-398] ----KQLTILGSTGSIGNSTLSVV---RANPELFKVTALVAGRNVREM---------AQQCLEFSPRYAAMSDEHSAKSLRLLLAEQGSD-TEVYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVK-RSRAQLLPIDSEHNAIFQSLPE------RI--QRQLGY--S--S-----LNENG-VSRIILTGSGGPFRETPLSQFSDVTPDQACA------GRKISVDSATMMNKGLEYIEARWLFNASAEQIEVVLHPQSVIHSMVRYHDGSILAQMGTPDMRTPIAHAMAYPMRVSSGVAPLDFCKVGALTFTTPDYQRYPCLKLAIDACNAGQAATTALNAANEISVMAFLDSKIRFTDIEVINRTVV---EGLLLS--E-PT--SVEEVLVIDRKARDVAAQVIAK---
21 PsiBlast_CBE 96.6057%-117 - C1 -4ZN6 DXR_ACIB3 B:[11-406] ----QSVCILGVTGSIGRSTLKIL---GQHPDKYSVFAVSAHSRISEL---------VEICKQFRPKVVVVPEQKIA-ELKTLFAQQNISDIDVLAGQEGLVDIASHTDVDIVMAAIVGAAGLLPTLAAVKAGKRVLLANKEALVMSGEIMMQAAR-DHQALLLPVDSEHNAIFQSLPH------NYLQA-------DRTG-----QPQLG-VSKILLTASGGPFLNHSLEQLVHVTPQQA---------QKISVDSATLMNKGLELIEACHLFSISEHFVTVVVHPQSIIHSMVQYVDGSTLAQMGNPDMCTPIAHALAWPERLQTNVPALDLFEYSQLNFQAPDTQKFPALNLARQAMRAGGLAPTILNAANEIAVEAFLMERIGFTSIPQVVEHTL---EKLENA--A-AE--SIECILDKDKVARSVAQQYISSIGG
29 PsiBlast_CBE 96.3657%-111 - C1 -3ANM DXR_ECOLI B:[12-407] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
5 PsiBlast_PDB 96.1857%-112 - C1 -1T1S DXR_ECOLI A:[2-397] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
27 PsiBlast_CBE 96.1357%-115 - C1 -3R0I DXR_ECOLI B:[14-409] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACR-----MGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
1 PsiBlast_PDB 96.1257%-115 - C1 -4ZN6 DXR_ACIB3 A:[11-406] ----QSVCILGVTGSIGRSTLKIL---GQHPDKYSVFAVSAHSRISEL---------VEICKQFRPKVVVVPEQKIA-ELKTLFAQQNISDIDVLAGQEGLVDIASHTDVDIVMAAIVGAAGLLPTLAAVKAGKRVLLANKEALVMSGEIMMQAAR-DHQALLLPVDSEHNAIFQSLPH------NYLQA-------DRTG-----QPQLG-VSKILLTASGGPFLNHSLEQLVHVTPQQACK-----MGQKISVDSATLMNKGLELIEACHLFSISEHFVTVVVHPQSIIHSMVQYVDGSTLAQMGNPDMCTPIAHALAWPERLQTNVPALDLFEYSQLNFQAPDTQKFPALNLARQAMRAGGLAPTILNAANEIAVEAFLMERIGFTSIPQVVEHTL---EKLENA--A-AE--SIECILDKDKVARSVAQQYISSIGG
24 PsiBlast_CBE 96.1057%-109 - C1 -1T1R DXR_ECOLI B:[2-397] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
23 PsiBlast_CBE 96.0457%-109 - C1 -1T1S DXR_ECOLI B:[2-397] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
11 PsiBlast_PDB 95.7757%-110 - C1 -3ANL DXR_ECOLI A:[12-407] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
13 PsiBlast_PDB 95.6157%-110 - C1 -3ANN DXR_ECOLI A:[12-407] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
17 PsiBlast_PDB 95.1255%-110 - C1 -1JVS DXR_ECOLI A:[2-397] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
14 PsiBlast_PDB 95.1057%-109 - C1 -2EGH DXR_ECOLI A:[12-407] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
111 HHSearch 94.8358%-106 - C1 -1Q0Q DXR_ECOLI A:[9-406] ---MKQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQ------PI--Q-------H--NLGYADLEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLAS
30 PsiBlast_CBE 94.7757%-109 - C1 -3ANL DXR_ECOLI B:[12-407] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
31 PsiBlast_CBE 94.6457%-110 - C1 -2EGH DXR_ECOLI B:[12-407] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
28 PsiBlast_CBE 94.6357%-109 - C1 -3ANN DXR_ECOLI B:[12-407] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
22 PsiBlast_CBE 94.6157%-109 - C1 -1Q0Q DXR_ECOLI B:[10-405] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
12 PsiBlast_PDB 94.5557%-108 - C1 -3ANM DXR_ECOLI A:[12-407] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
9 PsiBlast_PDB 93.2257%-111 - C1 -1ONP DXR_ECOLI A:[2-397] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
3 PsiBlast_PDB 93.1957%-106 - C1 -1Q0Q DXR_ECOLI A:[10-405] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
2 PsiBlast_PDB 92.7657%-104 - C1 -1Q0L DXR_ECOLI A:[10-405] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
25 PsiBlast_CBE 92.6057%-109 - C1 -1ONP DXR_ECOLI B:[2-397] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
16 PsiBlast_PDB 92.3855%-106 - C1 -1Q0H DXR_ECOLI A:[10-405] ----KQLTILGSTGSIGCSTLDVV---RHNPEHFRVVALVAGKNVTRM---------VEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSR-TEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVK-QSKAQLLPVDSEHNAIFQSLPQPIQHNLGY--A-------D--------LEQNG-VVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVL---EKMDMR--E-PQ--CVDDVLSVDANAREVARKEVMRLA-
47 PsiBlast_CBE 82.5334%-115 - C1 -3AU8 DXR_PLAFX B:[77-484] ---PINVAIFGSTGSIGTNALNIIRECNKIENVFNVKALYVNKSVNELYEQAREFLPEYLCIHDKSVYEELKELVKNIK--------DYK-PIILCGDEGMKEICSSNSIDKIVIGIDSFQGLYSTMYAIMNNKIVALANKESIVSAGFFLKKLLNIHKNAKIIPVDSEHSAIFQCLDN------NK--VLKTKCLQD--N-----FSKINNINKIFLCSSGGPFQNLTMDELKNVTSENALKHPKW---KKITIDSATMMNKGLEVIETHFLFDVDYNDIEVIVHKECIIHSCVEFIDKSVISQMYYPDMQIPILYSLTWPDRIKTNLKPLDLAQVSTLTFHKPSLEHFPCIKLAYQAGIKGNFYPTVLNASNEIANNLFLNNKIKYFDISSIISQVLESFNSQKVSENS-ED--LMKQILQIHSWAKDKATDIYNK---