@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA3724: (2016-02-20 )
MKKVSTLDLLFVAIMGVSPAAFAADLIDVSKLPSKAAQGAPGPVTLQAAVGAGGADELKAIRSTTLPNGKQVTRYEQFHNGVRVVGEAITEVKGPGKSVAAQRSGHFVANIAADLPGSTTAAVSAEQVLAQAKSLKAQGRKTENDKVELVIRLGENNIAQLVYNVSYLIPGEGLSRPHFVIDAKTGEVLDQWEGLAHAEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL

Atome Classification :

(86 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220..---.....230.......240.......250.......260.......270.......280.......290....-----...300.......310.......320-.......330........340.......350.......360.......370.......380.......---390.......400.......410......----.420.......430....--------...440.......450.......460.......470...----....480.......490......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKKVSTLDLLFVAIMGVSPAAFAADLIDVSKLPSKAAQGAPGPVTLQAAVGAGGADELKAIRSTTLPNGKQVTRYEQFHNGVRVVGEAITEVKGPGKSVAAQRSGHFVANIAADLPGSTTAAVSAEQVLAQAKSLKAQGRKTENDKVELVIRLGENNIAQLVYNVSYLIPGEGLSRPHFVIDAKTGEVLDQWEGLAHAEAGGPGGNQKIGKYTYGSDYGPLIVN---DRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHK-----LYMKVHYGRSVENAYWDGTAMLFGDG-ATMFYPLVS-LDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKK---GSGALRYMDQPSRDGRSIDNASQYYNGID----VHHSSGVYNRAFYLLANS--------PGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQN----RNYSAADVTRAFSTVGVTCPSAL
3 PsiBlast_PDB 99.70100% -72 - C12 -3DBK ELAS_PSEAE A:[1-298] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AEAGGPGGNQKIGKYTYGSDYGPLIVN---DRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHK-----LYMKVHYGRSVENAYWDGTAMLFGDG-ATMFYPLVS-LDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKK---GSGALRYMDQPSRDGRSIDNASQYYNGID----VHHSSGVYNRAFYLLANS--------PGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQN----RNYSAADVTRAFSTVGVTCP---
1 PsiBlast_PDB 99.67100% -74 - C12 -1U4G ELAS_PSEAE A:[1-298] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AEAGGPGGNQKIGKYTYGSDYGPLIVN---DRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHK-----LYMKVHYGRSVENAYWDGTAMLFGDG-ATMFYPLVS-LDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKK---GSGALRYMDQPSRDGRSIDNASQYYNGID----VHHSSGVYNRAFYLLANS--------PGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQN----RNYSAADVTRAFSTVGVTCP---
2 PsiBlast_PDB 99.47100% -73 - C12 -1EZM ELAS_PSEAE A:[1-298] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AEAGGPGGNQKIGKYTYGSDYGPLIVN---DRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHK-----LYMKVHYGRSVENAYWDGTAMLFGDG-ATMFYPLVS-LDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKK---GSGALRYMDQPSRDGRSIDNASQYYNGID----VHHSSGVYNRAFYLLANS--------PGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQN----RNYSAADVTRAFSTVGVTCP---
4 PsiBlast_PDB 98.6699% -71 - C12 -4K89 ? A:[1-298] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AEAGGPGGNQKIGKYTYGSDYGPLIVN---DRCEMDDGNVITVDMNGSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHK-----LYMKVHYGRSVENAYWDGTAMLFGDG-ATMFYPLVS-LDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKK---GSGALRYMDQPSRDGRSIDNASQYYNGID----VHHSSGVYNRAFYLLANS--------PGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQN----RNYSAADVTRAFSTVGVTCP---
111 HHSearch 87.5360% -71 - C12 -3NQX ? A:[2-299] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NATGPGGNLKTGKYLYGTDFDSLDVSQSGNTCSMNNANVRTINLNGGTS--GSSAYSFTCPENTFKEINGAYSPLNDAHFFGNVIFNMYNDWLGTAPLSFQ-----LQMRVHYSSNYENAFWDGSAMTFGDG-QNTFYPLVS-LDVSAHEVSHGFTEQNSGLIYNGKPGGLNEAFSDMAGEAAEFYMKGSNDWLVGKDIFK---GNGALRYMNNPTQDGRSIDNQSNYYSGMD----VHYSSGVYNKAFYNLATT--------PGWDTQKAFIVMARANQLYWSAGVGWDLAGNGVMDAACD----LNYDPNDVKAALAAVGVNSN---
5 PsiBlast_PDB 87.4260% -69 - C12 -3NQX ? A:[1-296] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ANATGPGGNLKTGKYLYGTDFDSLDVSQSGNTCSMNNANVRTINLNGGT--SGSSAYSFTCPENTFKEINGAYSPLNDAHFFGNVIFNMYNDWLGTAPLSFQ-----LQMRVHYSSNYENAFWDGSAMTFGDG-QNTFYPLVS-LDVSAHEVSHGFTEQNSGLIYNGKPGGLNEAFSDMAGEAAEFYMKGSNDWLVGKDIFK---GNGALRYMNNPTQDGRSIDNQSNYYSGMD----VHYSSGVYNKAFYNLATT--------PGWDTQKAFIVMARANQLYWSAGVGWDLAGNGVMDAACD----LNYDPNDVKAALAAVGV------
7 PsiBlast_PDB 86.5560% -69 - C12 -3NQZ ? B:[1-296] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ANATGPGGNLKTGKYLYGTDFDSLDVSQSGNTCSMNNANVRTINLNGGT--SGSSAYSFTCPENTFKEINGAYSPLNDAHFFGNVIFNMYNDWLGTAPLSFQ-----LQMRVHYSSNYENAFWDGSAMTFGDG-QNTFYPLVS-LDVSAHEVSHGFTEQNSGLIYNGKPGGLNAAFSDMAGEAAEFYMKGSNDWLVGKDIFK---GNGALRYMNNPTQDGRSIDNQSNYYSGMD----VHYSSGVYNKAFYNLATT--------PGWDTQKAFIVMARANQLYWSAGVGWDLAGNGVMDAACD----LNYDPNDVKAALAAVGV------
6 PsiBlast_PDB 86.2360% -68 - C12 -3NQY ? B:[1-296] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ANATGPGGNLKTGKYLYGTDFDSLDVSQSGNTCSMNNANVRTINLNGGT--SGSSAYSFTCPENTFKEINGAYSPLNDAHFFGNVIFNMYNDWLGTAPLSFQ-----LQMRVHYSSNYENAFWDGSAMTFGDG-QNTFYPLVS-LDVSAHAVSHGFTEQNSGLIYNGKPGGLNEAFSDMAGEAAEFYMKGSNDWLVGKDIFK---GNGALRYMNNPTQDGRSIDNQSNYYSGMD----VHYSSGVYNKAFYNLATT--------PGWDTQKAFIVMARANQLYWSAGVGWDLAGNGVMDAACD----LNYDPNDVKAALAAVGV------
67 PsiBlast_CBE 72.0433% -59 - C12 -1FJW THER_BACTH A:[68-315] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------APAVDAHYYAGVTYDYYKNVH--NRLSYDGNNAAIRSSVHYSQGYNNAFWNGSEMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDP-DHYSKRYTGTQDNGGVHINSGIINKAAYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGV------
26 PsiBlast_CBE 72.0333% -60 - C12 -5TLI THER_BACTH A:[68-315] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------APAVDAHYYAGVTYDYYKNVH--NRLSYDGNNAAIRSSVHYSQGYNNAFWNGSEMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDP-DHYSKRYTGTQDNGGVHINSGIINKAAYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGV------
23 PsiBlast_CBE 72.0133% -58 - C12 -7TLI THER_BACTH A:[68-315] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------APAVDAHYYAGVTYDYYKNVH--NRLSYDGNNAAIRSSVHYSQGYNNAFWNGSEMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDP-DHYSKRYTGTQDNGGVHINSGIINKAAYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGV------
27 PsiBlast_CBE 71.9733% -56 - C12 -4TLN THER_BACTH A:[68-315] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------APAVDAHYYAGVTYDYYKNVH--NRLSYDGNNAAIRSSVHYSQGYNNAFWNGSEMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDP-DHYSKRYTGTQDNGGVHINSGIINKAAYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGV------
11 PsiBlast_PDB 71.9233% -59 - C12 -4TMN THER_BACTH E:[68-315] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------APAVDAHYYAGVTYDYYKNVH--NRLSYDGNNAAIRSSVHYSQGYNNAFWNGSEMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDP-DHYSKRYTGTQDNGGVHINSGIINKAAYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGV------
71 PsiBlast_CBE 71.8933% -61 - C12 -1FJQ THER_BACTH A:[68-315] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------APAVDAHYYAGVTYDYYKNVH--NRLSYDGNNAAIRSSVHYSQGYNNAFWNGSEMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDP-DHYSKRYTGTQDNGGVHINSGIINKAAYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGV------
28 PsiBlast_CBE 71.8533% -62 - C12 -4TLI THER_BACTH A:[68-315] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------APAVDAHYYAGVTYDYYKNVH--NRLSYDGNNAAIRSSVHYSQGYNNAFWNGSEMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDP-DHYSKRYTGTQDNGGVHINSGIINKAAYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGV------
80 PsiBlast_CBE 71.8433% -58 - C12 -4MWP THER_BACTH E:[68-315] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------APAVDAHYYAGVTYDYYKNVH--NRLSYDGNNAAIRSSVHYSQGYNNAFWNGSQMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDP-DHYSKRYTGTQDNGGVHINSGIINKAAYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGV------
83 PsiBlast_CBE 71.8233% -60 - C12 -4D91 THER_BACTH A:[68-315] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------APAVDAHYYAGVTYDYYKNVH--NRLSYDGNNAAIRSSVHYSQGYNNAFWNGSQMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDP-DHYSKRYTGTQDNGGVHINSGIINKAAYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGV------
57 PsiBlast_CBE 71.8133% -57 - C12 -1QF2 THER_BACTH A:[68-315] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------APAVDAHYYAGVTYDYYKNVH--NRLSYDGNNAAIRSSVHYSQGYNNAFWNGSEMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDP-DHYSKRYTGTQDNGGVHINSGIINKAAYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGV------
33 PsiBlast_CBE 71.7833% -60 - C12 -3T2I THER_BACTH E:[68-315] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------APAVDAHYYAGVTYDYYKNVH--NRLSYDGNNAAIRSSVHYSQGYNNAFWNGSEMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDP-DHYSKRYTGTQDNGGVHINSGIINKAAYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGV------
13 PsiBlast_PDB 71.7733% -59 - C12 -6TMN THER_BACTH E:[68-315] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------APAVDAHYYAGVTYDYYKNVH--NRLSYDGNNAAIRSSVHYSQGYNNAFWNGSEMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDP-DHYSKRYTGTQDNGGVHINSGIINKAAYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGV------