@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA3816: (2016-02-21 )
MFERVREDIQSVFHRDPAARNALEVLTCYPGLHAVWLHRLAHGLWTSGWKWLARLVSNFGRWMTGIEIHPGARIGRRFFIDHGMGIVIGETAEIGDDVTLYQGVTLGGTTWNKGKRHPTLGNNVVVGAGAKVLGPFTVGEGAKVGSNAVVTKEVPPGATVVGIPGRIIMREDSEQQAKRQAMAEKLGFDAYGVSQDMPDPVARAIGQLLDHLQAVDGRLEGMCQALTALGSDYCAKDLPVLREEDFAGVKDEDGNPAA

Atome Classification :

(27 SA) ------------------------------------------------------------------------.........10........20........30........40........50........60........70........80........90........100.......110--------.--------......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ------------------------------------------------------------------------MFERVREDIQSVFHRDPAARNALEVLTCYPGLHAVWLHRLAHGLWTSGWKWLARLVSNFGRWMTGIEIHPGARIGRRFFIDHGMGIVIGETAEIGDDVTLYQGVTLGGTTWN--------K--------GKRHPTLGNNVVVGAGAKVLGPFTVGEGAKVGSNAVVTKEVPPGATVVGIPGRIIMREDSEQQAKRQAMAEKLGFDAYGVSQDMPDPVARAIGQLLDHLQAVDGRLEGMCQALTALGSDYCAKDLPVLREEDFAGVKDEDGNPAA
125 Fugue 93.0443%-115 - C1 -1SSQ CYSE_HAEIN A:[1-241] MNLDVWQHIRQEAKELAENEPMLASFFHSTILKHQNLGGALSYLLANKLANPIMPAISLREIIEEAYQSNPSIIDCAACDIQAVRHRDPAVELWSTPLLYLKGFHAIQSYRITHYLWNQNRKSLALYLQNQISVAFDVDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQGVTLGGTGKE--------S--------GDRHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVS-----------------------------------------------------------------------------------------
21 PsiBlast_CBE 80.8947%-116 - C1 -4H7O ? C:[84-251] -------------------------------------------------------------------------------DICATVNRDPAVSMYSMPLLYLKGYHALQGYRVANWLWRQGRKALATYFQNQISVACQVDIHPAARIGRGIMLDHATGIVIGETAVVEDDVSILQDVTLGGTGKE--------C--------GDRHPKIREGVMIGAGAKILGNIEVGEGAKIGSGSVVLQAVPPHTTVAGVPARIVGRPQSDK-----------------------------------------------------------------------------------
132 HHSearch 80.5843%-114 * C1 *1SSQ CYSE_HAEIN A:[74-241] -------------------------------------------------------------------------IDCAACDIQAVRHRDPAVELWSTPLLYLKGFHAIQSYRITHYLWNQNRKSLALYLQNQISVAFDVDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQGVTLGGTGKE--------S--------GDRHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVS-----------------------------------------------------------------------------------------
1 PsiBlast_PDB 79.3447%-112 - C1 -4H7O ? A:[84-251] -------------------------------------------------------------------------------DICATVNRDPAVSMYSMPLLYLKGYHALQGYRVANWLWRQGRKALATYFQNQISVACQVDIHPAARIGRGIMLDHATGIVIGETAVVEDDVSILQDVTLGGTGKE--------C--------GDRHPKIREGVMIGAGAKILGNIEVGEGAKIGSGSVVLQAVPPHTTVAGVPARIVGRPQSDK-----------------------------------------------------------------------------------
22 PsiBlast_CBE 78.6947%-112 - C1 -4H7O ? B:[84-251] -------------------------------------------------------------------------------DICATVNRDPAVSMYSMPLLYLKGYHALQGYRVANWLWRQGRKALATYFQNQISVACQVDIHPAARIGRGIMLDHATGIVIGETAVVEDDVSILQDVTLGGTGKE--------C--------GDRHPKIREGVMIGAGAKILGNIEVGEGAKIGSGSVVLQAVPPHTTVAGVPARIVGRPQSDK-----------------------------------------------------------------------------------
36 PsiBlast_CBE 78.6644%-124 - C1 -1SST CYSE_HAEIN C:[80-240] -------------------------------------------------------------------------------DIQAVRHRDPAVELWSTPLLYLKGFHAIQSYRITHYLWNQNRKSLALYLQNQISVAFDVDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQGVTLGGTG--------------------DRHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIV------------------------------------------------------------------------------------------
4 PsiBlast_PDB 78.5344%-117 - C1 -1SSQ CYSE_HAEIN A:[80-241] -------------------------------------------------------------------------------DIQAVRHRDPAVELWSTPLLYLKGFHAIQSYRITHYLWNQNRKSLALYLQNQISVAFDVDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQGVTLGGTGKE--------S--------GDRHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVS-----------------------------------------------------------------------------------------
44 PsiBlast_CBE 78.3942%-111 - C1 -3GVD ? F:[80-254] ------------------------------------------------------------------------MIVSAARDILAVRLRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHATGIVIGETAVVENDVSILQSVTLGGTGKT--------S--------GDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVGKPESDK-----------------------------------------------------------------------------------
35 PsiBlast_CBE 78.2644%-110 - C1 -1SSQ CYSE_HAEIN D:[80-249] -------------------------------------------------------------------------------DIQAVRHRDPAVELWSTPLLYLKGFHAIQSYRITHYLWNQNRKSLALYLQNQISVAFDVDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQGVTLGGTGKE--------S--------GDRHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVSQDKAAKPA---------------------------------------------------------------------------------
47 PsiBlast_CBE 78.2042%-115 - C1 -3GVD ? C:[80-254] ------------------------------------------------------------------------MIVSAARDILAVRLRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHATGIVIGETAVVENDVSILQSVTLGGTGKT--------S--------GDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVGKPESDK-----------------------------------------------------------------------------------
2 PsiBlast_PDB 78.0843%-124 - C1 -4HZD ? A:[91-254] ----------------------------------------------------------------------------LRVDIQAVYDRDPAYSRFMDPVLYLKGFHAIQTHRLAHWLYKQGRKDFAYYLQSRSSSIFQTDIHPAARLGSGLFLDHATGLVVGETAVVEDNVSILHGVTLGGTGKS--------S--------GDRHPKIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARII------------------------------------------------------------------------------------------
10 PsiBlast_PDB 77.9942%-111 - C1 -3GVD ? A:[80-254] ------------------------------------------------------------------------MIVSAARDILAVRLRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHATGIVIGETAVVENDVSILQSVTLGGTGKT--------S--------GDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVGKPESDK-----------------------------------------------------------------------------------
48 PsiBlast_CBE 77.9142%-107 - C1 -3GVD ? B:[80-254] ------------------------------------------------------------------------MIVSAARDILAVRLRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHATGIVIGETAVVENDVSILQSVTLGGTGKT--------S--------GDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVGKPESDK-----------------------------------------------------------------------------------
38 PsiBlast_CBE 77.9042%-111 - C1 -3GVD ? L:[80-254] ------------------------------------------------------------------------MIVSAARDILAVRLRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHATGIVIGETAVVENDVSILQSVTLGGTGKT--------S--------GDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVGKPESDK-----------------------------------------------------------------------------------
46 PsiBlast_CBE 77.6842%-109 - C1 -3GVD ? D:[80-254] ------------------------------------------------------------------------MIVSAARDILAVRLRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHATGIVIGETAVVENDVSILQSVTLGGTGKT--------S--------GDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVGKPESDK-----------------------------------------------------------------------------------
5 PsiBlast_PDB 77.4744%-130 - C1 -1SST CYSE_HAEIN A:[80-240] -------------------------------------------------------------------------------DIQAVRHRDPAVELWSTPLLYLKGFHAIQSYRITHYLWNQNRKSLALYLQNQISVAFDVDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQGVTLGGT-----------------------HPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIV------------------------------------------------------------------------------------------
39 PsiBlast_CBE 77.4642%-110 - C1 -3GVD ? K:[80-254] ------------------------------------------------------------------------MIVSAARDILAVRLRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHATGIVIGETAVVENDVSILQSVTLGGTGKT--------S--------GDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVGKPESDK-----------------------------------------------------------------------------------
53 PsiBlast_CBE 76.9543%-128 - C1 -4N6B ? B:[95-255] -------------------------------------------------------------------------------DLRAARERDPACVSYSHCLLNYKGFLACQAHRVAHLLWRQSRRPLALALHSRIANVFAVDIHPAARIGKGILFDHATGVVVGETAVIGNNVSILHHVTLGGT--------------------GDRHPKIGDGVLIGAGATILGNIKIGEGAKVGAGSVVLIDVPPRTTAVGNPARLV------------------------------------------------------------------------------------------
3 PsiBlast_PDB 76.8943%-120 - C1 -4HZC ? A:[91-254] ----------------------------------------------------------------------------LRVDIQAVYDRDPAYSRFMDPVLYLKGFHAIQTHRLAHWLYKQGRKDFAYYLQSRSSSIFQTDIHPAARLGSGLFLDHATGLVVGETAVVEDNVSILHGVTLGGTGKS--------S--------GDRHPKIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARII------------------------------------------------------------------------------------------
37 PsiBlast_CBE 76.8844%-124 - C1 -1SST CYSE_HAEIN B:[80-240] -------------------------------------------------------------------------------DIQAVRHRDPAVELWSTPLLYLKGFHAIQSYRITHYLWNQNRKSLALYLQNQISVAFDVDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQGVTLGGT---------------------DRHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIV------------------------------------------------------------------------------------------
7 PsiBlast_PDB 76.8745%-120 - C1 -1T3D CYSE_ECOLI A:[100-260] -------------------------------------------------------------------------------DIQAVRTRDPAVDKYSTPLLYLKGFHALQAYRIGHWLWNQGRRALAIFLQNQVSVTFQVDIHPAAKIGRGIMLDHATGIVVGETAVIENDVSILQSVTLGGTGKS--------G--------GDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIV------------------------------------------------------------------------------------------
11 PsiBlast_PDB 75.1643%-121 - C1 -4N69 ? A:[95-255] -------------------------------------------------------------------------------DLRAARERDPACVSYSHCLLNYKGFLACQAHRVAHLLWRQSRRPLALALHSRIANVFAVDIHPAARIGKGILFDHATGVVVGETAVIGNNVSILHHVTLGGTGKV--------G--------GDRHPKIGDGVLIGAGATILGNIKIGEGAKVGAGSVVLIDVPPRTTAVGNPARLV------------------------------------------------------------------------------------------
133 HHSearch 75.0739%-123 - C1 -3Q1X ? A:[100-267] -------------------------------------------------------------------------KRTLKTDLIAAYAGDPAAPGLSLIIRCYPGFQAVIVYRIAHVLYECGERYYCREMMESVHSYTSIDIHPGASIKGHFFIDHGVGVVIGETAIIGEWCRIYQSVTLGAMHFQEEGGVIKRG--------TKRHPTVGDYVTIGTGAKVLGNIIVGSHVRIGANCWIDRDVDSNQTVY-------------------------------------------------------------------------------------------------
55 PsiBlast_CBE 74.9943%-124 - C1 -4N69 ? B:[95-255] -------------------------------------------------------------------------------DLRAARERDPACVSYSHCLLNYKGFLACQAHRVAHLLWRQSRRPLALALHSRIANVFAVDIHPAARIGKGILFDHATGVVVGETAVIGNNVSILHHVTLGGTGKV--------G--------GDRHPKIGDGVLIGAGATILGNIKIGEGAKVGAGSVVLIDVPPRTTAVGNPARLV------------------------------------------------------------------------------------------
14 PsiBlast_PDB 74.4240%-123 - C1 -3P47 ? A:[105-268] ----------------------------------------------------------------------------LKTDLIAAYAGDPAAPGLSLIIRCYPGFQAVIVYRIAHVLYECGERYYCREMMESVHSYTSIDIHPGASIKGHFFIDHGVGVVIGETAIIGEWCRIYQSVTLGAMHFQ--------EEGGVIKRGTKRHPTVGDYVTIGTGAKVLGNIIVGSHVRIGANCWIDRDVDSNQTV--------------------------------------------------------------------------------------------------
16 PsiBlast_PDB 73.9740%-128 - C1 -3Q1X ? A:[103-266] ----------------------------------------------------------------------------LKTDLIAAYAGDPAAPGLSLIIRCYPGFQAVIVYRIAHVLYECGERYYCREMMESVHSYTSIDIHPGASIKGHFFIDHGVGVVIGETAIIGEWCRIYQSVTLGAMHFQ--------EEGGVIKRGTKRHPTVGDYVTIGTGAKVLGNIIVGSHVRIGANCWIDRDVDSNQTV--------------------------------------------------------------------------------------------------
150 HHSearch 35.3137% -83 - C1 -3MQG ? A:[101-159] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RDTIVRQGATLGANCTVVCGATIGRYAFVGAGAVVNKDVPDFALVVGVPARQIGWMSRH------------------------------------------------------------------------------------