@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA3823: (2016-02-21 )
MNFELLATDGKARRGRLTFPRGVVETPAFMPVGTYGTVKGMLPRDIEDIGAQIILGNTFHLWLRPGTEVIQRHGDLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVTFASPVDGAKVFMGPEESMAVQRALGSDIVMIFDECTPYPADHDVAKRSMELSLRWAKRSKIAHGDSPSALFGIVQGGMHEDLRLRSLDGLQEIGFDGLAIGGLSVGEPKEEMIRVLDFLPPQMPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFVDSGVIKIRNSVHKHDDSTLDPTCDCYTCKHFSRAYLHHLDKCGEMLGSMLNTIHNLRHYQRVMAGLREAIQQGTLAAFVDAFYAKRGLPTPPLDA

Atome Classification :

(50 SA) ---.........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170..-----.-----..-----..180.......190.......200.......210......---.220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350.......360.......370
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ---MNFELLATDGKARRGRLTFPRGVVETPAFMPVGTYGTVKGMLPRDIEDIGAQIILGNTFHLWLRPGTEVIQRHGDLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVTFASPVDGAKVFMGPEESMAVQRALGSDIVMIFDECTPYPADHDVAKRSMELSLRWAKRSKIAHG-----D-----SP-----SALFGIVQGGMHEDLRLRSLDGLQEIGFDGLAIGGLSVGEP---KEEMIRVLDFLPPQMPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFVDSGVIKIRNSVHKHDDSTLDPTCDCYTCKHFSRAYLHHLDKCGEMLGSMLNTIHNLRHYQRVMAGLREAIQQGTLAAFVDAFYAKRGLPTPPLDA
59 PsiBlast_CBE 97.3354% -89 - C4 -4Q8V TGT_ZYMMO A:[16-382] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSH---SRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFD-----SRKEQAEN-----AALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
72 PsiBlast_CBE 97.3053% -90 - C4 -4Q8M TGT_ZYMMO A:[16-382] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFD-----SRKEQAEN-----AALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGTGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
82 PsiBlast_CBE 97.2854% -88 - C4 -4GD0 TGT_ZYMMO A:[14-380] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGFQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDEVTPYPATPSRAASSMERSMRWAKRSRDAFD-----SRKEQAEN-----AALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
87 PsiBlast_CBE 97.1653% -87 - C4 -4IPP TGT_ZYMMO A:[14-380] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFD-----SRKEQAEN-----AALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGDGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
84 PsiBlast_CBE 97.1653% -88 - C4 -4Q8P TGT_ZYMMO A:[16-382] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSL---TKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFD-----SRKEQAEN-----AALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGDGKPDDIVGAVERGIDMFDCVLPTR--RNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
60 PsiBlast_CBE 97.1154% -89 - C4 -4LEQ TGT_ZYMMO A:[16-382] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKS-LDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFD-----SRKEQAEN-----AALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
81 PsiBlast_CBE 97.0454% -88 - C4 -4H7Z TGT_ZYMMO A:[14-380] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGFQVM-----TKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDEVTPYPATPSRAASSMERSMRWAKRSRDAFD-----SRKEQAEN-----AALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
13 PsiBlast_PDB 96.9954% -86 - C4 -1P0B TGT_ZYMMO A:[14-380] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSH----RHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFD-----S-----RKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
58 PsiBlast_CBE 96.9154% -89 - C4 -4Q8W TGT_ZYMMO A:[16-382] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSS-TKQSEEGVTFKSH---SRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFD-----SRKEQAEN-----AALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
11 PsiBlast_PDB 96.9154% -88 - C4 -1Q2R TGT_ZYMMO A:[14-380] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFD-----S-----RKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
83 PsiBlast_CBE 96.8854% -87 - C4 -4E2V TGT_ZYMMO A:[14-380] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGFQVM------KQSEEGVTFKSH---SRHMLSPERSIEIQHLLGSDIVMAFDEVTPYPATPSRAASSMERSMRWAKRSRDAFD-----SRKEQAEN-----AALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
31 PsiBlast_CBE 96.6354% -88 - C4 -4PUK TGT_ZYMMO A:[14-380] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSH---SRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFD-----S-----RKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
102 Fugue 96.5954% -88 - C4 -1K4G TGT_ZYMMO A:[11-382] RPRFSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQA-----EN-----AALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAV---GEGQDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYF--------
63 PsiBlast_CBE 96.5953% -87 - C4 -1EFZ TGT_ZYMMO A:[14-380] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDAGGYQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFD-----S-----RKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
55 PsiBlast_CBE 96.5854% -89 - C4 -1Q2R TGT_ZYMMO C:[14-380] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFD-----S-----RKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
42 PsiBlast_CBE 96.5454% -90 - C4 -3RR4 TGT_ZYMMO A:[14-380] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLS-LTKQSEEGVTFKSH---SRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFD-----S-----RKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
79 PsiBlast_CBE 96.5254% -87 - C4 -4DXX TGT_ZYMMO A:[15-380] ----SFSIAAREGKARTGTIEMKRGVIRTPAFMPVGT--TVMALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFD-----SRKEQAEN-----AALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------
28 PsiBlast_CBE 96.4854% -90 - C4 -4Q4O TGT_ZYMMO A:[14-380] ---FSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFK-----SRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFD-----S-----RKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRAR----------