@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA4110: (2016-02-23 )
MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR

Atome Classification :

(80 SA) .........10........20........30..-......40........50........60........70........80........90........100.......110.......120.......130.......140-.......150.......160.......170.......180.......190.......200.......210.......220.......230.........240.......250.......260.......270.-.......280.......290.......300.......310.......320.......330----.........340.......350.......360.......370.......380.......390.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MRDTRFPCLCGIAASTLLFATTPAIAGEAPADR-LKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGG-LPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGY--GKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERL-D-RPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPA------PQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR
7 PsiBlast_PDB 97.85100% -95 - C1 -4WYY ? A:[1-360] ----------------------------APADR-LKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGG-LPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGY--GKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERL-D-RPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPA------PQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLE---------
6 PsiBlast_PDB 97.84100% -94 - C1 -4NK3 AMPC_PSEAE A:[7-367] ----------------------------APADR-LKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGG-LPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGY--GKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERL-D-RPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPA------PQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQ--------
1 PsiBlast_PDB 97.67100% -93 - C1 -2WZX AMPC_PSEAE A:[2-363] ---------------------------EAPADR-LKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGG-LPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGY--GKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERL-D-RPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPA------PQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQ--------
8 PsiBlast_PDB 97.49100% -94 - C1 -4WZ4 ? A:[1-360] ----------------------------APADR-LKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGG-LPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGY--GKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERL-D-RPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPA------PQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLE---------
2 PsiBlast_PDB 97.32100% -94 - C1 -2WZZ AMPC_PSEAE A:[3-362] ----------------------------APADR-LKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGG-LPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGY--GKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERL-D-RPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPA------PQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLE---------
3 PsiBlast_PDB 97.30100% -93 - C1 -4GZB AMPC_PSEAE A:[3-369] ----------------------------APADR-LKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGG-LPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGY--GKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERL-D-RPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPA------PQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPL--
10 PsiBlast_PDB 96.8499% -93 - C1 -4HEF AMPC_PSEAE A:[1-360] ----------------------------APADR-LKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGG-LPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGY--GKRDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERL-D-RPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPA------PQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLE---------
5 PsiBlast_PDB 96.68100% -93 - C1 -3S22 AMPC_PSEAE A:[3-363] ----------------------------APADR-LKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGG-LPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGY--GKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERL-D-RPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPA------PQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQ--------
9 PsiBlast_PDB 96.47100% -94 - C1 -4OOY AMPC_PSEAE A:[1-359] ----------------------------APADR-LKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGG-LPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGY--GKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERL-D-RPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPA------PQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGL----------
4 PsiBlast_PDB 96.37100% -89 - C1 -3S1Y AMPC_PSEAE A:[3-363] ----------------------------APADR-LKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGG-LPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGY--GKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERL-D-RPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPA------PQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQ--------
21 PsiBlast_CBE 96.33100% -94 - C1 -4X68 AMPC_PSEAE B:[2-357] -------------------------------DR-LKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGG-LPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGY--GKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERL-D-RPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPA------PQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGL----------
11 PsiBlast_PDB 96.25100% -93 - C1 -4X68 AMPC_PSEAE A:[2-357] -------------------------------DR-LKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGG-LPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGY--GKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERL-D-RPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPA------PQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGL----------
12 PsiBlast_PDB 82.8359% -97 - C1 -2QZ6 - AMPC_PSEFL A:[7-360] --------------------------------D-IRQVVDSTVEPLMQQQDIAGLSVAVIQNGKAQYFNYGVANKDSKQPITENTLFEIGSVSKTFTATLAGYALANGKLKLSDPASQYLPALRGDKFDHISLLNLGTYTAGG-LPLQFP------TGKMISYYQHWKPAFAPGTQRLYSNPSIGLFGHLAAQSLGQPFEKLMEQTVLPKLGLKHTFISVPETQMSLYAQGY--DKAGKPVRVSPGALDAEAYGIKTSTSDLIHYVEVNMHPAKL-E-KPLQQAIAATHTGYYTVDGMTQGLGWEMYPYPIKVDALVEGNSTQMAMEPHKVNWLTP------PQAAPLDTLVNKTGSTGGFGAYVAYVPSKGLGVVILANKNYPNAERVKAAHAILSAM----------
110 HHSearch 82.7059% -98 - C1 -2QZ6 - AMPC_PSEFL A:[7-360] --------------------------------D-IRQVVDSTVEPLMQQQDIAGLSVAVIQNGKAQYFNYGVANKDSKQPITENTLFEIGSVSKTFTATLAGYALANGKLKLSDPASQYLPALRGDKFDHISLLNLGTYTA-GGLPLQFP------TGKMISYYQHWKPAFAPGTQRLYSNPSIGLFGHLAAQSLGQPFEKLMEQTVLPKLGLKHTFISVPETQMSLYAQGY--DKAGKPVRVSPGALDAEAYGIKTSTSDLIHYVEVNMHPAKL-E-KPLQQAIAATHTGYYTVDGMTQGLGWEMYPYPIKVDALVEGNSTQMAMEPHKVNWLTP------PQAAPLDTLVNKTGSTGGFGAYVAYVPSKGLGVVILANKNYPNAERVKAAHAILSAM----------
15 PsiBlast_PDB 82.6956% -95 - C1 -3W8K ? A:[28-378] -------------------------------DP-LRPVVDASIQPLLKEHRIPGMAVAVLKDGKAHYFNYGVANRESGASVSEQTLFEIGSVSKTLTATLGAYAVVKGAMQLDDKASRHAPWLKGSVFDSITMGELATYSAGG-LPLQFPEEVDSSE-KMRAYYRQWAPVYSPGSHRQYSNPSIGLFGHLAASSLKQPFAQLMEQTLLPGLGMHHTYVNVPKQAMASYAYGY--SKEDKPIRV--GMLADEAYGIKTSSADLLAFVKANIGGVD--D-KALQQAISLTHKGHYSVGGMTQGLGWESYAYPVTEQTLLAGNSAKVILEANPTA---A------PR----QVLFNKTGSSNGFGAYVAFVPARGIGIVMLANRNYPIPARVKAAHAILAQL----------
47 PsiBlast_CBE 82.3744% -86 - C1 -1FR6 ? A:[7-361] --------------------------------Q-IADIVNRTITPLMQEQAIPGMAVAIIYQGKPYYFTWGKADIANNRPVTQQTLFELGSVSKTFNGVLGGDAIARGEIKLSDPVTQYWPELTGKQWQGISLLHLATYTAGG-LPLQVPDDV-TDKAALLRFYQNWQPQWAPGAKRLYANSSIGLFGALAVKPSGMSYEEAMSKRVLHPLKLAHTWITVPQSEQKDYAWGY---REGKPVHVSPGQLDAEAYGVKSSVIDMTRWVQANMDASQVQE-KTLQQGIELAQSRYWRIGDMYQGLGWEMLNWPVKADSIISGSDSKVALAALPAVEVNP------PAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLANKSYPNPVRVEAAWRILEKLQ---------
112 HHSearch 82.2756% -97 * C1 *3W8K ? A:[28-379] -------------------------------DP-LRPVVDASIQPLLKEHRIPGMAVAVLKDGKAHYFNYGVANRESGASVSEQTLFEIGSVSKTLTATLGAYAVVKGAMQLDDKASRHAPWLKGSVFDSITMGELATYSA-GGLPLQFPEEVDS-SEKMRAYYRQWAPVYSPGSHRQYSNPSIGLFGHLAASSLKQPFAQLMEQTLLPGLGMHHTYVNVPKQAMASYAYGY--SKEDKPIRV--GMLADEAYGIKTSSADLLAFVKANIGGVD--D-KALQQAISLTHKGHYSVGGMTQGLGWESYAYPVTEQTLLAG---------NSAKVILEANPTAAPR----QVLFNKTGSSNGFGAYVAFVPARGIGIVMLANRNYPIPARVKAAHAILAQLA---------
13 PsiBlast_PDB 81.9756% -93 - C1 -1ZKJ ? A:[7-357] -------------------------------DP-LRPVVDASIQPLLKEHRIPGMAVAVLKDGKAHYFNYGVANRESGAGVSEQTLFEIGSVSKTLTATLGAYAVVKGAMQLDDKASRHAPWLKGSAFDSITMGELATYSAGG-LPLQFPEEVDSSE-KMRAYYRQWAPVYSPGSHRQYSNPSIGLFGHLAASSLKQPFAPLMEQTLLPGLGMHHTYVNVPKQAMASYAYGY--SKEDKPIRVNPGMLADEAYGIKTSSADLLRFVKANIGGVD--D-KALQQAISLTHQGHYSVGGMTQGLGWESYAYPVTEQTLLAGNSAKVILEANPTA---A------PRE---QVLFNKTGSTNGFGAYVAFVPARGIGIVMLANRNYPIEARIKAAHAILAQL----------
27 PsiBlast_CBE 81.9041% -95 - C1 -4U0T ? F:[4-359] -----------------------------PKDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSNTIFELGSVSKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGN-LALQFPDEVQTDQ-QVLTFFKDWKP-NPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLKHSYVNVPKTQMQNYAFGY--NQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLNPQKY-P-TDIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISK------EPSV---KMYHKTGSTSGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYVVLNAIK---------
18 PsiBlast_PDB 81.6742% -90 - C1 -4QD4 ? A:[5-361] -----------------------------PKDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSSTIFELGSVSKLFTATAGAYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGN-LALQFPDEVQTDQ-QVLTFFKDWKPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKIIFPALGLKHSYVNVAKTQMQNYAFGY--NQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLNPQKY-P-ADIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISK------EPSV---KMYHKTGSTNGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLNAIKK--------
14 PsiBlast_PDB 81.0656% -93 - C1 -4WBG ? A:[28-378] -------------------------------DP-LRPVVDASIQPLLKEHRIPGMAVAVLKDGKAHYFNYGVANRESGASVSEQTLFEIGSVSKTLTATLGAYAVVKGAMQLDDKASRHAPWLKGSVFDSITMGELATYSAGG-LPLQFPEEVDSSE-KMRAYYRQWAPVYSPGSHRQYSNPSIGLFGHLAASSLKQPFAQLMEQTLLPGLGMHHTYVNVPKQAMASYAYGY--SKEDKPIRV--GMLADEAYGIKTSSADLLAFVKANIGGVD--D-KALQQAISLTHKGHYSVGGMTQGLGWESYAYPVTEQTLLAGNSAKVILEANPTA---A------PR----QVLFNKTGSSNGFGAYVAFVPARGIGIVMLANRNYPIPARVKAAHAILAQL----------