@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA4728: (2016-02-29 )
MIQRVYVALGSNLAEPREQIQAALDAFERLPETRLVAVSPLYISDPLGPADQPRFVNGVAALDTNLAPLDLLDALQAIELEQGRVRDLRWGPRTLDLDILLFGEQLLDLPRLKVPHYHMQARAFVLYPLADLAPDLRLPDGRHLPELLAACPFEGIERLPGA

Atome Classification :

(61 SA) .........10........20........30........40........50..-----......60........70........80..-....-.-.-.---90........100----..-----...-..110.......120.......130.-......140-.......150.......160
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MIQRVYVALGSNLAEPREQIQAALDAFERLPETRLVAVSPLYISDPLGPADQP-----RFVNGVAALDTNLAPLDLLDALQAIEL-EQ-GRVR-D-L-R---WGPRTLDLDILLF----GE-----QLL-DLPRLKVPHYHMQARAFVLYPLADLA-PDLRLPDGR-HLPELLAACPFEGIERLPGA
84 HHSearch 96.5959%-128 - C7 -2QX0 ? A:[1-158] -MIRVYIALGSNLAMPLQQVSAAREALAHLPRSRLVACSPLYRTKPLGPQDQP-----DFLNAVVALDTSLPPEQLLDHTQAIER-NQ-GRVR-KEQ-R---WGPRTLDLDIMLY----GD-----QVI-KTDRLTIPHYGLKAREFMLYPLADIA-PDLIFPDGE-SLSECLKRVDKNGLVL----
1 PsiBlast_PDB 94.9759%-132 - C7 -2QX0 ? A:[3-156] ---RVYIALGSNLAMPLQQVSAAREALAHLPRSRLVACSPLYRTKPLGPQDQP-----DFLNAVVALDTSLPPEQLLDHTQAIER-NQ-GRVRKE-Q-R---WGPRTLDLDIMLY----GD-----QVI-KTDRLTIPHYGLKAREFMLYPLADIA-PDLIFPDGE-SLSECLKRVDKNGL------
83 HHSearch 93.4051%-129 - C7 -1CBK HPPK_HAEIN A:[1-159] -MITAYIALGSNLNTPVEQLHAALKAISQLSNTHLVTTSSFYKSKPLGPQDQP-----DYVNAVAKIETELSPLKLLDELQRIEN-EQ-GRVR-L-R-R---WGERTLDLDILLY----GN-----EII-QNERLTIPHYDMHNREFVIVPLFEIA-SDLVLPNSQ-IITELVKQFADHKMIKLN--
9 PsiBlast_PDB 93.0951%-129 - C7 -4M5N HPPK_ECOLI A:[8-161] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
43 PsiBlast_CBE 92.8350%-138 - C7 -3HD1 HPPK_ECOLI A:[4-157] -----YIAIGSALASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
24 PsiBlast_CBE 92.7751%-137 - C7 -3UDE HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GR------ER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
73 Fugue 92.7650%-131 - C7 -1CBK HPPK_HAEIN A:[1-160] -MITAYIALGSNLNTPVEQLHAALKAISQLSNTHLVTTSSFYKSKPLGPQDQP-----DYVNAVAKIETELSPLKLLDELQRIEN-EQ-GRVRL--R-R---WGERTLDLDILLY----GN-----EII-QNERLTIPHYDMHNREFVIVPLFEIA-SDLVLPNSQ-IITELVKQFADHKMIKLNP-
7 PsiBlast_PDB 92.3651%-129 - C7 -4M5L HPPK_ECOLI A:[8-161] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
30 PsiBlast_CBE 92.1951%-136 - C7 -3HSD HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DALNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
2 PsiBlast_PDB 92.1651%-128 - C7 -4M5G HPPK_ECOLI A:[8-161] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
45 PsiBlast_CBE 92.1150%-139 - C7 -3HT0 HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGAMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
8 PsiBlast_PDB 92.0951%-130 - C7 -4M5M HPPK_ECOLI A:[8-161] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
19 PsiBlast_PDB 92.0351%-133 - C7 -1HKA - HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
11 PsiBlast_PDB 91.9651%-127 - C7 -1EX8 HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
47 PsiBlast_CBE 91.9250%-127 - C7 -3KUH HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPAYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
4 PsiBlast_PDB 91.9151%-127 - C7 -4M5I HPPK_ECOLI A:[8-161] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
37 PsiBlast_CBE 91.8650%-127 - C7 -1F9H HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPATLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
21 PsiBlast_CBE 91.8651%-131 - C7 -4M5N HPPK_ECOLI B:[8-161] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
29 PsiBlast_CBE 91.7351%-135 - C7 -3HSD HPPK_ECOLI B:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DALNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
15 PsiBlast_PDB 91.7151%-137 - C7 -1RAO HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
12 PsiBlast_PDB 91.6751%-133 - C7 -1EQM HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
16 PsiBlast_PDB 91.6551%-127 - C7 -1RB0 HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
31 PsiBlast_CBE 91.6350%-137 - C7 -3HD2 HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDAP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
28 PsiBlast_CBE 91.5751%-132 - C7 -3HSG HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DALNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
6 PsiBlast_PDB 91.5651%-129 - C7 -4M5K HPPK_ECOLI A:[8-161] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
3 PsiBlast_PDB 91.5251%-126 - C7 -4M5H HPPK_ECOLI A:[8-161] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
10 PsiBlast_PDB 91.3651%-129 - C7 -1DY3 HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
23 PsiBlast_CBE 91.2951%-138 - C7 -3UDV HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GR------ER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
14 PsiBlast_PDB 91.2451%-127 - C7 -1Q0N HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
20 PsiBlast_PDB 91.2251%-141 - C7 -3UD5 HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
38 PsiBlast_CBE 91.2050%-129 - C7 -3ILO HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLAIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
42 PsiBlast_CBE 90.9950%-135 - C7 -3HSJ HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLAAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
5 PsiBlast_PDB 90.8151%-133 - C7 -4M5J HPPK_ECOLI A:[8-161] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR----ER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
46 PsiBlast_CBE 90.7650%-130 - C7 -3HSZ HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGAMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
44 PsiBlast_CBE 90.6750%-135 - C7 -3HCX HPPK_ECOLI A:[4-157] -----YIAIGSALASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
40 PsiBlast_CBE 90.3550%-127 - C7 -3ILJ HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLALDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
22 PsiBlast_CBE 90.0451%-126 - C7 -4F7V HPPK_ECOLI A:[4-157] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-GRVR-K-AER---WGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----
54 PsiBlast_CBE 89.8149%-143 - C7 -1RTZ HPPK_ECOLI A:[4-151] -----YIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQP-----DYLNAAVALETSLAPEELLNHTQRIEL-QQ-G--------R---GGPRTLDLDIMLF----GN-----EVI-NTERLTVPHYDMKNRGFMLWPLFEIA-PELVFPDGE-MLRQILHTRAFDKLNK----