@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA4730: (2016-02-29 )
MNTVKTVRELRAAVARARSEGKRIGFVPTMGNLHAGHAALVKKAGERADFVVVSIFVNPLQFGPSEDLDTYPRTLAADQERLLEAGCHLLFTPTVEEMYPDGMDGQTRIHVPGVSEGLCGASRPGHFEGVATVVSKLLNMVQPDLALFGEKDFQQLAVIRKLVRDLNLPVQIFGEPTVRAADGLALSSRNGYLDEQQRAAAPAIYRTLRQLGERIRAGAEDFPALLADARQALEQAGLRPDYLEIREPISLRPGVPGDRQLVILAAAYLGSTRLIDNLSVHLD

Atome Classification :

(98 SA) .........10......-..20........30........40.....-.-..50........60........70........80........90........100-........110-.......-120.......130.......140.......150.......160.......170.......180.......190.......200.....------..210.......220.......230.-.-.--....-240.......250---.--.---....----.-.260.......270.......280.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNTVKTVRELRAAVARA-RSEGKRIGFVPTMGNLHAGHAALVKKAGE-R-ADFVVVSIFVNPLQFGPSEDLDTYPRTLAADQERLLEAGCHLLFTPTVEEMYPD--GMDGQTRIHVP-GVSEGLC-GASRPGHFEGVATVVSKLLNMVQPDLALFGEKDFQQLAVIRKLVRDLNLPVQIFGEPTVRAADGLALSSRNGYLDEQQRAAAPAIYRT------LRQLGERIRAGAEDFPALLADARQAL-E-Q--AGLR-PDYLEIREPISL----R--P---GVPG----D-RQLVILAAAYLGSTRLIDNLSVHLD
1 PsiBlast_PDB 93.5052%-121 - C6 -3MUE PANC_SALTY A:[4-285] MLIIETLPLLRQHIRRL-RQEGKRVALVPTMGNLHDGHMKLVDEAKA-R-ADVVIVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPH--GLEGQTYVDVP-GLSTMLE-GASRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIRKMVADMSYDIEIVGVPIIRAKDGLALSSRNAYLTAEQRKIAPGLYNV------MNSIAEKLIAGNRELQEIIAIAEQEL-N-E--KGFR-ADDIQIRDADTL----L--E---LTET----S-KRAVILAAAWLGQARLIDNQSVTL-
24 PsiBlast_CBE 92.6252%-119 - C6 -1IHO PANC_ECOLI B:[1-282] MLIIETLPLLRQQIRRL-RMEGKRVALVPTMGNLHDGHMKLVDEAKA-R-ADVVVVSIFVNPMQFDRPEDLARYPRTLQEDCEKLNKRKVDLVFAPSVKEIYPN--GTETHTYVDVP-GLSTMLE-GASRPGHFRGVSTIVSKLFNLVQPDIACFGEKDFQQLALIRKMVADMGFDIEIVGVPIMRAKDGLALSSRNGYLTAEQRKIAPGLYKV------LSSIADKLQAGERDLDEIITIAGQEL-N-E--KGFR-ADDIQIRDADTL----L--E---VSET----S-KRAVILVAAWLGDARLIDNKMVEL-
29 PsiBlast_CBE 92.6052%-116 - C6 -3Q10 PANC_YERPE C:[4-285] MLIIETLPLLRQQIRRW-RQEGKRIALVPTMGNLHEGHMTLVDEAKT-R-ADVVVVTIFVNPLQFERPDDLAHYPRTLQEDCEKLTRHGADLVFAPAAADIYPA--GLEKQTYVDVP-ALSTILE-GASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDYQQLALIRKMVADMGYDINIVGVPTVRAKDGLALSSRNGYLTEEERQIAPQLSKI------MWALAEKMALGERQIDALLEEAAAQL-L-R--VGFT-PDELFIRDAETL----Q--P---LTVD----S-QQAVILMAAWLGKARLIDNQLVDL-
22 PsiBlast_CBE 92.3252%-119 - C6 -3MUE PANC_SALTY C:[4-285] MLIIETLPLLRQHIRRL-RQEGKRVALVPTMGNLHDGHMKLVDEAKA-R-ADVVIVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPH--GLEGQTYVDVP-GLSTMLE-GASRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIRKMVADMSYDIEIVGVPIIRAKDGLALSSRNAYLTAEQRKIAPGLYNV------MNSIAEKLIAGNRELQEIIAIAEQEL-N-E--KGFR-ADDIQIRDADTL----L--E---LTET----S-KRAVILAAAWLGQARLIDNQSVTL-
33 PsiBlast_CBE 92.0749%-113 - C6 -3INN PANC_BRUME C:[22-298] MQIIHTIEELRQALAPA-RQQGKKIGFVPTMGYLHKGHLELVRRARV-E-NDVTLVSIFVNPLQFGANEDLGRYPRDLERDAGLLHDAQVDYLFAPTVSDMYPR--PM--QTVVDVP-PLGNQIE-GEARPGHFAGVATVVSKLFNIVGPDAAYFGEKDFQQLVIIRRMVDDMAIPVRIVGVETVREDDGLACSSRNVYLTPEQRRAAIIVPQA------LDEADRLYRSGMDDPDALEAAIRTFI-G-R--QPLAVPEVIAIRDPETL----ERLP---ALQG------RPILVALFVRVGATRLLDN------
108 HHSearch 91.9453%-112 - C6 -3Q12 PANC_YERPE A:[4-285] MLIIETLPLLRQQIRRW-RQEGKRIALVPTMGNLHEGHMTLVDEAKT-R-ADVVVVTIFVNPLQFERPDDLAHYPRTLQEDCEKLTRHGADLVFAPAAADIYPA--GLEKQTYVDVP-ALSTILE-GASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDYQQLALIRKMVADMGYDINIVGVPTVRAKDGLALSSRNGYLTEEERQIAPQLSKI------MWALAEKMALGERQIDALLEEAAAQL-L-R--VGFT-PDELFIRDAETL----Q--P---LTVD----S-QQAVILMAAWLGKARLIDNQLVDL-
27 PsiBlast_CBE 91.8652%-115 - C6 -3Q12 PANC_YERPE B:[4-285] MLIIETLPLLRQQIRRW-RQEGKRIALVPTMGNLHEGHMTLVDEAKT-R-ADVVVVTIFVNPLQFERPDDLAHYPRTLQEDCEKLTRHGADLVFAPAAADIYPA--GLEKQTYVDVP-ALSTILE-GASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDYQQLALIRKMVADMGYDINIVGVPTVRAKDGLALSSRNGYLTEEERQIAPQLSKI------MWALAEKMALGERQIDALLEEAAAQL-L-R--VGFT-PDELFIRDAETL----Q--P---LTVD----S-QQAVILMAAWLGKARLIDNQLVDL-
122 Fugue 91.7552%-117 - C6 -1IHO PANC_ECOLI A:[1-282] MLIIETLPLLRQQIRRL-RMEGKRVALVPTMGNLHDGHMKLVDEAKA-R-ADVVVVSIFVNPMQFDRPEDLARYPRTLQEDCEKLNKRKVDLVFAPSVKEIYPN--GTETHTYVDVP-GLSTMLE-GASRPGHFRGVSTIVSKLFNLVQPDIACFGEKDFQQLALIRKMVADMGFDIEIVGVPIMRAKDGLALSSRNGYLTAEQRKIAPGLYKV------LSSIADKLQAGERDLDEIITIAGQEL-N-E--KGFR-ADDIQIRDADTL----L--E---VSET----S-KRAVILVAAWLGDARLIDNKMVEL-
2 PsiBlast_PDB 91.7552%-117 - C6 -1IHO PANC_ECOLI A:[1-282] MLIIETLPLLRQQIRRL-RMEGKRVALVPTMGNLHDGHMKLVDEAKA-R-ADVVVVSIFVNPMQFDRPEDLARYPRTLQEDCEKLNKRKVDLVFAPSVKEIYPN--GTETHTYVDVP-GLSTMLE-GASRPGHFRGVSTIVSKLFNLVQPDIACFGEKDFQQLALIRKMVADMGFDIEIVGVPIMRAKDGLALSSRNGYLTAEQRKIAPGLYKV------LSSIADKLQAGERDLDEIITIAGQEL-N-E--KGFR-ADDIQIRDADTL----L--E---VSET----S-KRAVILVAAWLGDARLIDNKMVEL-
4 PsiBlast_PDB 91.5552%-112 - C6 -3Q12 PANC_YERPE A:[4-285] MLIIETLPLLRQQIRRW-RQEGKRIALVPTMGNLHEGHMTLVDEAKT-R-ADVVVVTIFVNPLQFERPDDLAHYPRTLQEDCEKLTRHGADLVFAPAAADIYPA--GLEKQTYVDVP-ALSTILE-GASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDYQQLALIRKMVADMGYDINIVGVPTVRAKDGLALSSRNGYLTEEERQIAPQLSKI------MWALAEKMALGERQIDALLEEAAAQL-L-R--VGFT-PDELFIRDAETL----Q--P---LTVD----S-QQAVILMAAWLGKARLIDNQLVDL-
21 PsiBlast_CBE 91.0152%-125 - C6 -3MUE PANC_SALTY D:[4-285] MLIIETLPLLRQHIRRL-RQEGKRVALVPTMGNLHDGHMKLVDEAKA-R-ADVVIVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPH--GLEGQTYVDVP-GLSTMLE-GASRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIRKMVADMSYDIEIVGVPIIRAKDGLALSSRNAYLTAEQRKIAPGLYNV------MNSIAEKLIAGNRELQEIIAIAEQEL-N-E--KGFR-ADDIQIRDADTL----L--E---LTET----S-KRAVILAAAWLGQARLIDNQSVTL-
30 PsiBlast_CBE 90.9952%-114 - C6 -3Q10 PANC_YERPE B:[4-285] MLIIETLPLLRQQIRRW-RQEGKRIALVPTMGNLHEGHMTLVDEAKT-R-ADVVVVTIFVNPLQFERPDDLAHYPRTLQEDCEKLTRHGADLVFAPAAADIYPA--GLEKQTYVDVP-ALSTILE-GASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDYQQLALIRKMVADMGYDINIVGVPTVRAKDGLALSSRNGYLTEEERQIAPQLSKI------MWALAEKMALGERQIDALLEEAAAQL-L-R--VGFT-PDELFIRDAETL----Q--P---LTVD----S-QQAVILMAAWLGKARLIDNQLVDL-
25 PsiBlast_CBE 90.9452%-118 - C6 -3Q12 PANC_YERPE D:[4-285] MLIIETLPLLRQQIRRW-RQEGKRIALVPTMGNLHEGHMTLVDEAKT-R-ADVVVVTIFVNPLQFERPDDLAHYPRTLQEDCEKLTRHGADLVFAPAAADIYPA--GLEKQTYVDVP-ALSTILE-GASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDYQQLALIRKMVADMGYDINIVGVPTVRAKDGLALSSRNGYLTEEERQIAPQLSKI------MWALAEKMALGERQIDALLEEAAAQL-L-R--VGFT-PDELFIRDAETL----Q--P---LTVD----S-QQAVILMAAWLGKARLIDNQLVDL-
26 PsiBlast_CBE 90.8452%-113 - C6 -3Q12 PANC_YERPE C:[4-285] MLIIETLPLLRQQIRRW-RQEGKRIALVPTMGNLHEGHMTLVDEAKT-R-ADVVVVTIFVNPLQFERPDDLAHYPRTLQEDCEKLTRHGADLVFAPAAADIYPA--GLEKQTYVDVP-ALSTILE-GASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDYQQLALIRKMVADMGYDINIVGVPTVRAKDGLALSSRNGYLTEEERQIAPQLSKI------MWALAEKMALGERQIDALLEEAAAQL-L-R--VGFT-PDELFIRDAETL----Q--P---LTVD----S-QQAVILMAAWLGKARLIDNQLVDL-
3 PsiBlast_PDB 90.5852%-112 - C6 -3Q10 PANC_YERPE A:[4-285] MLIIETLPLLRQQIRRW-RQEGKRIALVPTMGNLHEGHMTLVDEAKT-R-ADVVVVTIFVNPLQFERPDDLAHYPRTLQEDCEKLTRHGADLVFAPAAADIYPA--GLEKQTYVDVP-ALSTILE-GASRPGHFRGVSTIVSKLFNLIQPDVACFGEKDYQQLALIRKMVADMGYDINIVGVPTVRAKDGLALSSRNGYLTEEERQIAPQLSKI------MWALAEKMALGERQIDALLEEAAAQL-L-R--VGFT-PDELFIRDAETL----Q--P---LTVD----S-QQAVILMAAWLGKARLIDNQLVDL-
7 PsiBlast_PDB 90.3249%-114 - C6 -3INN PANC_BRUME A:[22-298] MQIIHTIEELRQALAPA-RQQGKKIGFVPTMGYLHKGHLELVRRARV-E-NDVTLVSIFVNPLQFGANEDLGRYPRDLERDAGLLHDAQVDYLFAPTVSDMYPR--PM--QTVVDVP-PLGNQIE-GEARPGHFAGVATVVSKLFNIVGPDAAYFGEKDFQQLVIIRRMVDDMAIPVRIVGVETVREDDGLACSSRNVYLTPEQRRAAIIVPQA------LDEADRLYRSGMDDPDALEAAIRTFI-G-R--QPLAVPEVIAIRDPETL----ERLP---ALQG------RPILVALFVRVGATRLLDN------
23 PsiBlast_CBE 89.9952%-115 - C6 -3MUE PANC_SALTY B:[4-285] MLIIETLPLLRQHIRRL-RQEGKRVALVPTMGNLHDGHMKLVDEAKA-R-ADVVIVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPH--GLEGQTYVDVP-GLSTMLE-GASRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIRKMVADMSYDIEIVGVPIIRAKDGLALSSRNAYLTAEQRKIAPGLYNV------MNSIAEKLIAGNRELQEIIAIAEQEL-N-E--KGFR-ADDIQIRDADTL----L--E---LTET----S-KRAVILAAAWLGQARLIDNQSVTL-
102 HHSearch 89.4548%-111 - C6 -3INN PANC_BRUME A:[22-303] MQIIHTIEELRQALAPA-RQQGKKIGFVPTMGYLHKGHLELVRRARV-E-NDVTLVSIFVNPLQFGANEDLGRYPRDLERDAGLLHDAQVDYLFAPTVSDMYPR--PMQ--TVVDVP-PLGNQIE-GEARPGHFAGVATVVSKLFNIVGPDAAYFGEKDFQQLVIIRRMVDDMAIPVRIVGVETVREDDGLACSSRNVYLTPEQRRAAIIVPQA------LDEADRLYRSGMDDPDALEAAIRTFI-GRQ--PLAV-PEVIAIRDPETL----E--R---LPAL----QGRPILVALFVRVGATRLLDNRVIGH-
9 PsiBlast_PDB 88.9045%-121 - C6 -3UK2 PANC_BURTA A:[5-283] MKVISSIQELRDQL----RGQN-RTAFVPTMGNLHEGHLSLMRLARQ-H-GDPVVASIFVNRLQFGPNEDFDKYPRTLQEDIEKLQKENVYVLFAPTERDMYPE--PQ--EYRVQPPHDLGDILE-GEFRPGFFTGVCTVVTKLMACVQPRVAVFGKKDYQQLMIVRRMCQQLALPVEIVAAETVRDADGLALSSRNRYLSEAERAEAPELAKT------LARVRDAVLDGERDLAAIERRAVAHL-S-A--RGWQ-PDYVSIRRRENLVAPSA--A---QIEA----G-DPLVVLTAAKLGATRLIDNLEI---
106 HHSearch 88.5347%-120 - C6 -3UK2 PANC_BURTA A:[5-283] MKVISSIQELRDQL-----RGQNRTAFVPTMGNLHEGHLSLMRLARQ-H-GDPVVASIFVNRLQFGPNEDFDKYPRTLQEDIEKLQKENVYVLFAPTERDMYPE--PQE--YRVQPPHDLGDILE-GEFRPGFFTGVCTVVTKLMACVQPRVAVFGKKDYQQLMIVRRMCQQLALPVEIVAAETVRDADGLALSSRNRYLSEAERAEAPELAKT------LARVRDAVLDGERDLAAIERRAVAHL-S-A--RGWQ-PDYVSIRRRENL----V--A---PSAAQIEAG-DPLVVLTAAKLGATRLIDNLEI---
34 PsiBlast_CBE 88.1745%-122 - C6 -3UK2 PANC_BURTA B:[5-283] MKVISSIQELRDQL----RGQN-RTAFVPTMGNLHEGHLSLMRLARQ-H-GDPVVASIFVNRLQFGPNEDFDKYPRTLQEDIEKLQKENVYVLFAPTERDMYPE--PQ--EYRVQPPHDLGDILE-GEFRPGFFTGVCTVVTKLMACVQPRVAVFGKKDYQQLMIVRRMCQQLALPVEIVAAETVRDADGLALSSRNRYLSEAERAEAPELAKT------LARVRDAVLDGERDLAAIERRAVAHL-S-A--RGWQ-PDYVSIRRRENLVAPSA--A---QIEA----G-DPLVVLTAAKLGATRLIDNLEI---
103 HHSearch 87.3648%-110 - C6 -3COV PANC_MYCTU A:[12-288] LNVYSAPGDVADVSRAL-RLTGRRVMLVPTMGALHEGHLALVRAAKR-VPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPD--GLR--TTVQPG-PLAAELE-GGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAA------LTAAAHAATAGAQAA---LDAARAVLDA-A--PGVA-VDYLELRDIG-L----G--P---MP-L----N-GSGRLLVAARLGTTRLLDNIAIEI-
32 PsiBlast_CBE 87.3549%-119 - C6 -3INN PANC_BRUME D:[22-298] MQIIHTIEELRQALAPA-RQQGKKIGFVPTMGYLHKGHLELVRRARV-E-NDVTLVSIFVNPLQFGAN--------DLERDAGLLHDAQVDYLFAPTVSDMYPR--PM--QTVVDVP-PLGNQIE-GE--PGHFAGVATVVSKLFNIVGPDAAYFGEKDFQQLVIIRRMVDDMAIPVRIVGVETVREDDGLACSSRNVYLTPEQRRAAIIVPQA------LDEADRLYRSGMDDPDALEAAIRTFI-G-R--QPLAVPEVIAIRDPETL----ERLP---ALQG------RPILVALFVRVGATRLLDN------
104 HHSearch 87.2739%-110 - C6 -3MXT PANC_CAMJE A:[4-283] MQVITSVKEAKQIVKDW-KSHQLSIGYVPTMGFLHDGHLSLVKHAKT---QDKVIVSIFVNPMQFGPNEDFSSYPRDLERDIKMCQDNGVDMVFIPDATQMYLK--NFS--TYVDMN-TITDKLC-GAKRPGHFRGVCTVLTKFFNILNPDIVYMGQKDAQQCVVVRHMVDDLNFDLKIQICPIIREEDGLAKSSRNVYLSKEERKASLAISQS------IFLAEKLVREGEKNTSKIIQAMKDIL-EKE--KLIK-IDYIELVDFNTM----E--N---IENI----T-DNVLGAVAAFVGKTRLIDNFLVQG-
109 HHSearch 87.2352%-109 - C6 -1V8F PANC_THET8 A:[1-275] MRTVSTVAELRAAL------PREGVGFVPTMGYLHRGHLALVERARR-E-NPFVVVSVFVNPLQFGPGEDYHRYPRDLERDRALLQEAGVDLLFAPGVEEMYPE--GFA--TRVQVEGPLTALWE-GAVRPGHFQGVATVVARLFLLVQPQRAYFGEKDYQQLLVVRRMVRDLGFPVEVVGVPTVREEDGLALSSRNVYLSPETRKKAPVLYRA------LLAMREVAGQGGSVAEALRAG-EEAL-RAV--PEFR-KDYLAIVH<