@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PA4761: (2016-03-01 )
MGKIIGIDLGTTNSCVAILENGNVKVIENAEGARTTPSIIAYTNDGETLVGQPAKRQAVTNPQNTLYAVKRLIGRRFEENVVQKDIQMVPYSIVKADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGLDKAKGDHTVIVYDLGGGTFDVSVIEIAEVDGEHQFEVLATNGDTFLGGEDFDIRLIDYLVDEFKKESGINLKGDPLAMQRLKEAAEKAKIELSSTQQTDVNLPYVTADASGPKHLNVKVSRAKLESLVEDLVQRTIEPCRTALKDAGLDVSDIHEVILVGGQTRMPLVQKTVAEFFGKEARKDVNPDEAVAVGAAIQGAVLAGDVKDVLLLDVTPLTLGIETLGGVMTGLIEKNTTIPTKKSQVFSTADDNQGAVTIHVLQGERKQAAQNKSLGKFDLADIPPAPRGVPQIEVTFDIDANGILHVSAKDKATGKQQSIVIKASSGLSEDEIQQMVRDAEANAEEDRKFEELAAARNQGDALVHATRKMITEAGDKATAEDKATIEKALGELEAAVKGDDKAEIEAKMNALSQASTPLAQKMYAEQAQQGEDAPQGEQAKAADDVVDAEFEEVKDNK

Atome Classification :

(91 SA) .........10........20........30........40........50........60........70........80........90...-.-....100--...----.--.---.--.--110-........120.......130.......140.......150.......160.......170.......180-.---.------..-...190.......200.....-..210.......220.......230.......240...-....250.......260.......270.--......280..--.....290.......300.......310.-......320.......330.........340.......350.....-.-.360--........370.......380...----....390.......400...----....410.......420.......430......-.440.......450.......460.....-..470.......480.......----490.......500..-..-...510.......520.......530.......540.......550-.......560.......570.......----580.......590.......600.......610.......620.......630.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MGKIIGIDLGTTNSCVAILENGNVKVIENAEGARTTPSIIAYTNDGETLVGQPAKRQAVTNPQNTLYAVKRLIGRRFEENVVQKDIQMVPYSIV-K-ADNGDAW--VEV----K--G---Q--K--MA--PPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGLDVKRIINEPTAAALAYGLD-K---A------KG-DHTVIVYDLGGGTFDVSVIEI-AEVDGEHQFEVLATNGDTFLGGEDFDIRLIDYLVDEFK-KESGINLKGDPLAMQRLKEAAEKAKIEL--SSTQQTDVNLP--YVTADASGPKHLNVKVSRAKLESLVEDLV-QRTIEPCRTALKDAGLD--VSDIHEVILVGGQTRMPLVQKTVAEFF-G-KEA---RKDVNPDEAVAVGAAIQGAVLAGD----VKDVLLLDVTPLTLGIETLG----GVMTGLIEKNTTIPTKKSQVFSTADDNQGAVTI-HVLQGERKQAAQNKSLGKFDLADIPPAPR-GVPQIEVTFDIDANGILHVSAK----DKATGKQQSIVIKAS-SG-LSEDEIQQMVRDAEANAEEDRKFEELAAARNQGDALVHATRKMITE-AGDKATAEDKATIEKALGELEAAVKGD----DKAEIEAKMNALSQASTPLAQKMYAEQAQQGEDAPQGEQAKAADDVVDAEFEEVKDNK
4 PsiBlast_PDB 97.7677% -75 - C4 -4B9Q DNAK_ECOLI A:[2-600] -GKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGCTLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKII-A-ADNGDAW--VEV----K--G---Q--K--MA--PPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLD-K---G------TG-NRTIAVYDLGGGAFDISIIEI-DEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFK-KDQGIDLRNDPLAMQRLKEAAEKAKIEL--SSAQQTDVNLP--YITADATGPKHMNIKVTRAKLESLVEDLV-NRSIEPLKVALQDAGLS--VSDIDDVILVGGQTRMPMVQKKVAEFF-G-KEP---RKDVNPDEAVAIGAAVQGGVLTGD----VKDVLLLDVTPLSLGIETMG----GVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI-HVLQGERKRAADNKSLGQFNLDGINPAPR-GMPQIEVTFDIDADGILHVSAK----DKNSGKEQKITIKAS-SG-LNEDEIQKMVRDAEANAEADRKCEELVQTRNQGDHLLHSTRKQVEE-AGDKLPADDKTAIESALTALETALKGE----DKAAIEAKMQELAQVSQKLME-------------------------------------
22 PsiBlast_CBE 96.5078% -73 - C4 -4JN4 DNAK_ECOLI B:[2-596] -GKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKII-A-ADNGDAW--VEV----K--G---Q--K--MA--PPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLD-K---G------TG-NRTIAVYDLGGGAFDISIIEI-DEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFK-KDQGIDLRNDPLAMQRLKEAAEKAKIEL--SSAQQTDVNLP--YITADATGPKHMNIKVTRAKLESLVEDLV-NRSIEPLKVALQDAGLS--VSDIDDVILVGGQTRMPMVQKKVAEFF-G-KEP---RKDVNPDEAVAIGAAVQGGVLTGD----VKDVLLLDVTPLSLGIETMG----GVMTTLIAKNTTIPTKHSQVFSMG----GAVTI-HVLQGERKRAADNKSLGQFNLDGINPAPR-GMPQIEVTFDIDADGILHVSAK----DKNSGKEQKITIKAS-SG-LNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEE-AGDKLPADDKTAIESALTALETALKGE----DKAAIEAKMQELAQVSQKLME-------------------------------------
3 PsiBlast_PDB 96.4478% -71 - C4 -4JNE DNAK_ECOLI A:[2-596] -GKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKII-A-ADNGDAW--VEV----K--G---Q--K--MA--PPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLD-K---G------TG-NRTIAVYDLGGGAFDISIIEI-DEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFK-KDQGIDLRNDPLAMQRLKEAAEKAKIEL--SSAQQTDVNLP--YITADATGPKHMNIKVTRAKLESLVEDLV-NRSIEPLKVALQDAGLS--VSDIDDVILVGGQTRMPMVQKKVAEFF-G-KEP---RKDVNPDEAVAIGAAVQGGVLTGD----VKDVLLLDVTPLSLGIETMG----GVMTTLIAKNTTIPTKHSQVFSMG----GAVTI-HVLQGERKRAADNKSLGQFNLDGINPAPR-GMPQIEVTFDIDADGILHVSAK----DKNSGKEQKITIKAS-SG-LNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEE-AGDKLPADDKTAIESALTALETALKGE----DKAAIEAKMQELAQVSQKLME-------------------------------------
2 PsiBlast_PDB 96.2778% -73 - C4 -4JN4 DNAK_ECOLI A:[2-596] -GKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKII-A-ADNGDAW--VEV----K--G---Q--K--MA--PPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLD-K---G------TG-NRTIAVYDLGGGAFDISIIEI-DEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFK-KDQGIDLRNDPLAMQRLKEAAEKAKIEL--SSAQQTDVNLP--YITADATGPKHMNIKVTRAKLESLVEDLV-NRSIEPLKVALQDAGLS--VSDIDDVILVGGQTRMPMVQKKVAEFF-G-KEP---RKDVNPDEAVAIGAAVQGGVLTGD----VKDVLLLDVTPLSLGIETMG----GVMTTLIAKNTTIPTKHSQVFSMG----GAVTI-HVLQGERKRAADNKSLGQFNLDGINPAPR-GMPQIEVTFDIDADGILHVSAK----DKNSGKEQKITIKAS-SG-LNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEE-AGDKLPADDKTAIESALTALETALKGE----DKAAIEAKMQELAQVSQKLME-------------------------------------
21 PsiBlast_CBE 96.0778% -72 - C4 -4JNE DNAK_ECOLI B:[2-596] -GKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKII-A-ADNGDAW--VEV----K--G---Q--K--MA--PPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLD-K---G------TG-NRTIAVYDLGGGAFDISIIEI-DEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFK-KDQGIDLRNDPLAMQRLKEAAEKAKIEL--SSAQQTDVNLP--YITADATGPKHMNIKVTRAKLESLVEDLV-NRSIEPLKVALQDAGLS--VSDIDDVILVGGQTRMPMVQKKVAEFF-G-KEP---RKDVNPDEAVAIGAAVQGGVLTGD----VKDVLLLDVTPLSLGIETMG----GVMTTLIAKNTTIPTKHSQVFSMG----GAVTI-HVLQGERKRAADNKSLGQFNLDGINPAPR-GMPQIEVTFDIDADGILHVSAK----DKNSGKEQKITIKAS-SG-LNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEE-AGDKLPADDKTAIESALTALETALKGE----DKAAIEAKMQELAQVSQKLME-------------------------------------
1 PsiBlast_PDB 95.6479% -78 - C5 -2KHO - DNAK_ECOLI A:[4-600] ---IIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKII-A-ADNGDAW--VEV----K--G---Q--K--MA--PPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLD-K---G------TG-NRTIAVYDLGGGTFDISIIEI-DEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFK-KDQGIDLRNDPLAMQRLKEAAEKAKIEL--SSAQQTDVNLP--YITADATGPKHMNIKVTRAKLESLVEDLV-NRSIEPLKVALQDAGLS--VSDIDDVILVGGQTRMPMVQKKVAEFF-G-KEP---RKDVNPDEAVAIGAAVQGGVLTGD----VKDVLLLDVTPLSLGIETMG----GVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTI-HVLQGERKRAADNKSLGQFNLDGINPAPR-GMPQIEVTFDIDADGILHVSAK----DKNSGKEQKITIKAS-SG-LNEDEIQKMVRDAEANAEADRKFDELVQTRNQGDHLLHSTRKQVEE-AGDKLPADDKTAIESALTALETALKGE----DKAAIEAKMQELAQVSQKLME-------------------------------------
112 HHSearch 85.0967% -72 - C4 -2V7Y DNAK_GEOKA A:[1-504] MSKIIGIDLGTTNSCVAVLEGGEVKVIPNPEGNRTTPSVVAFKN-GERLVGEVAKRQAITNP-NTIISIKRHMGTDYKV----------------------------EI----E--G---K--Q--YT--PQEISAIILQYLKSYAEDYLGEPVTRAVITVPAYFNDAQRQATKDAGRIAGLEVERIINEPTAAALAYGLD-K---E-------E-DQTILVYDLGGGTFDVSILEL-G----DGVFEVKATAGDNHLGGDDFDQVIIDYLVNQFK-QEHGIDLSKDKMALQRLKDAAEKAKKEL--SGVTQTQISLP--FISANENGPLHLEMTLTRAKFEELSAHLV-ERTMGPVRQALQDAGLT--PADIDKVILVGGSTRIPAVQEAIKREL-G-KEP---HKGVNPDEVVAIGAAIQGGVIAGE----VKDVVLLDVTPLSLGIETMG----GVFTKLIERNTTIPTSKSQVFTTAADNQTTVDI-HVLQGERPMAADNKSLGRFQLTGIPPAPR-GVPQIEVTFDIDANGIVHVRAK----DLGTNKEQSITIKSS-SG-LSEEEIQRMIKEAEENAEADRKRKEAAEL-----------------------------------------------------------------------------------------------------------
5 PsiBlast_PDB 84.3563% -76 - C4 -2V7Y DNAK_GEOKA A:[1-504] MSKIIGIDLGTTNSCVAVLEGGEVKVIPNPEGNRTTPSVVAFKN-GERLVGEVAKRQAITNP-NTIISIKRHMGT--------------------------DYK--VEI----E--G---K--Q--YT--PQEISAIILQYLKSYAEDYLGEPVTRAVITVPAYFNDAQRQATKDAGRIAGLEVERIINEPTAAALAYGLD-K---E------E--DQTILVYDLGGGTFDVSILEL-----GDGVFEVKATAGDNHLGGDDFDQVIIDYLVNQFK-QEHGIDLSKDKMALQRLKDAAEKAKKEL--SGVTQTQISLP--FISANENGPLHLEMTLTRAKFEELSAHLV-ERTMGPVRQALQDAGLT--PADIDKVILVGGSTRIPAVQEAIKREL-G-KEP---HKGVNPDEVVAIGAAIQGGVIAGE----VKDVVLLDVTPLSLGIETMG----GVFTKLIERNTTIPTSKSQVFTTAADNQTTVDI-HVLQGERPMAADNKSLGRFQLTGIPPAPR-GVPQIEVTFDIDANGIVHVRAK----DLGTNKEQSITIKSS-SG-LSEEEIQRMIKEAEENAEADRKRKEAAEL-----------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 84.2963% -75 - C5 -4ANI - DNAK_GEOKA C:[1-509] MSKIIGIDLGTTNSCVAVLEGGEVKVIPNPEGNRTTPSVVAFKN-GERLVGEVAKRQAITNP-NTIISIKRHMGT--------------------------DYK--VEI----E--G---K--Q--YT--PQEISAIILQYLKSYAEDYLGEPVTRAVITVPAYFNDAQRQATKDAGRIAGLEVERIINEPTAAALAYGLD-K---E------E--DQTILVYDLGGGTFDVSILEL-----GDGVFEVKATAGDNHLGGDDFDQVIIDYLVNQFK-QEHGIDLSKDKMALQRLKDAAEKAKKEL--SGVTQTQISLP--FISANENGPLHLEMTLTRAKFEELSAHLV-ERTMGPVRQALQDAGLT--PADIDKVILVGGSTRIPAVQEAIKREL-G-KEP---HKGVNPDEVVAIGAAIQGGVIAGE----VKDVVLLDVTPLSLGIETMG----GVFTKLIERNTTIPTSKSQVFTTAADNQTTVDI-HVLQGERPMAADNKSLGRFQLTGIPPAPR-GVPQIEVTFDIDANGIVHVRAK----DLGTNKEQSITIKSS-SG-LSEEEIQRMIKEAEENAEADRKRKEAAELRNEAD------------------------------------------------------------------------------------------------------
8 PsiBlast_PDB 81.7753% -68 - C4 -1YUW - HSP7C_BOVIN A:[4-540] -GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAM