@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0206: (2015-11-29 )
MGNIKTISVKDNNVRLDRYIRRIFPNLKQSVIEKSLRRGLIKVNDCKAKSSDRVNSGQIITIKYLDYIENANSDCKHNEKLVELLRSNILYEDEYILAINKPAGVIVQGGIKVKISISDLLDQVREGETFKIVHRLDRDTSGAIIFARNANVARYLMEEFKGRRVKKTYLALTSGIPSKNRGVIDYPLVKKYVSGQEKVVIDKNSPQDATTRFSIIAKFKLNKPLVQRPIIQVADTQLYEHCNLSLSRVCHLSSLSSCYSSALLCHLSAPILVSSKTDHKQAHYTTFSIKKLDSSIMCRNDTRSVAYLKLQPITGRTHQLRTHLAYINCPILGDGKYGGKKAFVDGIASKIHLHSYSLSLKLPNNKKITITAPLPEHIKKSIEALHTPF

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FOU_E_9(2I82)
RLUA_ECOLI
[Raw transfer]
43 Fugue 97.1528% -82 - C6 -2IST - RLUD_ECOLI -
24 HHSearch 83.1231% -77 - C6 -1V9K - RLUC_ECOLI -
23 HHSearch 79.4328% -70 - C6 -1V9F - RLUD_ECOLI -
25 HHSearch 78.9332% -69 - C6 -2I82 3.3 RLUA_ECOLI
5 PsiBlast_PDB 67.0824% -68 - C6 -2IST - RLUD_ECOLI -
1 PsiBlast_PDB 61.0833% -89 - C6 -1XPI - RLUC_ECOLI -
3 PsiBlast_PDB 60.3533% -81 - C6 -2I82 - RLUA_ECOLI -
21 PsiBlast_CBE 59.5233% -95 - C6 -1XPI - RLUC_ECOLI -
2 PsiBlast_PDB 59.4732% -90 - C6 -1V9K - RLUC_ECOLI -
50 Fugue 58.6119% -50 - C4 -4X7P - ? -
27 HHSearch 58.3615% -52 - C6 -1KSK - RSUA_ECOLI -
28 HHSearch 54.8321% -74 - C6 -3DH3 - RLUF_ECOLI -
8 PsiBlast_PDB 53.7821% -77 - C6 -3DH3 - RLUF_ECOLI -
29 HHSearch 53.5019% -50 - C6 -2OML - RLUE_ECOLI -
26 HHSearch 53.2622% -60 * C6 *1VIO - RSUA_HAEIN -
4 PsiBlast_PDB 51.2124% -80 - C6 -1V9F - RLUD_ECOLI -
31 HHSearch 51.1419% -87 - C6 -2GML - RLUF_ECOLI -
44 Fugue 50.2420% -24 - C6 -1PRZ - RLUD_ECOLI -
30 HHSearch 47.6820% -77 - C6 -2OLW - RLUE_ECOLI -
15 PsiBlast_PDB 45.5822% -78 - C6 -2GML - RLUF_ECOLI -