@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0485: (2015-12-01 )
MNQSGNAVHYWWVHRISAVILLFLLPWFIYSFSYAFYANNSLSFNEKLFQAINHPLDLLFFVVLLFCIFWHAVLGMQVVCEDYIHSIPLRIFTITCIKYLSSITYIVLAFTIFFFYKHVFL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UQ2_D_13(1NEK)
DHSD_ECOLI
[Raw transfer]
27 Fugue 89.1221%-188 - C3 -4P6V - NQRB_VIBCH -
19 Fugue 88.5520%-168 - C3 -1NEK 4.1 DHSD_ECOLI
9 HHSearch 82.2120%-185 - C3 -2WDQ - DHSD_ECOLI -
8 PsiBlast_PDB 80.3125%-213 - C3 -2WU2 - DHSD_ECOLI -
1 PsiBlast_PDB 80.2625%-209 - C3 -1NEK - DHSD_ECOLI -
6 PsiBlast_PDB 79.8025%-207 - C3 -2WDR - DHSD_ECOLI -
7 PsiBlast_PDB 79.5625%-211 - C3 -2WP9 - DHSD_ECOLI -
4 PsiBlast_PDB 79.0425%-207 - C3 -2WDQ - DHSD_ECOLI -
5 PsiBlast_PDB 78.5225%-212 - C3 -2WDV - DHSD_ECOLI -
3 PsiBlast_PDB 78.2525%-209 - C3 -2ACZ - DHSD_ECOLI -
2 PsiBlast_PDB 77.3325%-205 - C3 -1NEN - DHSD_ECOLI -
10 HHSearch 74.2821%-196 - C3 -2H88 - DHSD_CHICK -
13 HHSearch 69.0215%-177 - C3 -2BS2 - FRDC_WOLSU -
22 Fugue 67.8720%-166 - C4 -1I8N - LAPP_HAEOF -
21 Fugue 65.9715%-199 * C4 *1J57 - ? -
20 Fugue 62.8915%-175 - C3 -1ZOY - C560_PIG -
26 Fugue 61.5314%-113 - C3 -4NOO - ? -
14 HHSearch 56.1911%-158 - C3 -2BS2 - FRDC_WOLSU -
11 HHSearch 54.1516%-147 - C3 -2H88 - ? -
23 Fugue 53.7320%-162 - C3 -2OD5 - ? -