@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA0470: (2016-03-15 )
MTHDYIVKALAFDGEIRAYAALTTETVQEAQTRHYTWPTASAAMGRTMTATAMMGAMLKGDQKLTVTVDGQGPIGRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGTNGSIIVVKDVGMKDYFSGASPIVSGELGEDFTYYYATSEQTPSSVGLGVLVNPDNTIKAAGGFIIQVMPGAKDETISKLEKAISEMTPVSKLIEQGLTPEGLLNEILGEDHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGAEAVCHFCGNKYKYTEEELNVLLESLA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UNL_A_7(1VQ0)
HSLO_THEMA
[Raw transfer]




UNL_A_7(1VQ0)
HSLO_THEMA
[Raw transfer]




UNL_B_8(1VQ0)
HSLO_THEMA
[Raw transfer]




21 HHSearch 98.8067%-100 - C3 -1VZY - HSLO_BACSU -
1 PsiBlast_PDB 97.9368% -98 - C3 -1VZY - HSLO_BACSU -
19 PsiBlast_CBE 97.7968%-102 - C3 -1VZY - HSLO_BACSU -
22 HHSearch 83.9937%-105 - C3 -1VQ0 3.9 HSLO_THEMA
20 PsiBlast_CBE 79.7636% -91 - C3 -1VQ0 4.0 HSLO_THEMA
2 PsiBlast_PDB 79.1636% -94 - C3 -1VQ0 3.9 HSLO_THEMA
5 PsiBlast_PDB 62.1625% -72 - C3 -3M7M - HSLO_ECOLI -
23 HHSearch 57.7622% -75 - C3 -1HW7 - HSLO_ECOLI -
3 PsiBlast_PDB 57.1226% -59 - C3 -1I7F - HSLO_ECOLI -
55 Fugue 56.2421% -58 - C3 -1I7F - HSLO_ECOLI -
4 PsiBlast_PDB 55.7125% -62 - C3 -1HW7 - HSLO_ECOLI -
58 Fugue 37.779% -35 - C1 -4CRU - RCD1_HUMAN -
57 Fugue 35.2434% 41 - C3 -1G39 - HNF1A_MOUSE -
59 Fugue 32.4535% 33 - C3 -1G39 - HNF1A_MOUSE -
48 HHSearch 32.3512% 15 - C3 -3NA7 - ? -
63 Fugue 32.1333% 41 - C3 -1G39 - HNF1A_MOUSE -
62 Fugue 31.1533% 33 * C3 *1G39 - HNF1A_MOUSE -
7 PsiBlast_PDB 28.9631% 6 - C4 -1TZH - ? -
10 PsiBlast_PDB 28.7859% 101 - C2 -3IP3 - ? -
17 PsiBlast_PDB 27.6730% 37 - C4 -3QO0 - ? -