@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA1102: (2016-03-22 )
MSDIINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPYDKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTEERRKERVKDVKKIGEEAKVSVRNIRRDMNDQLKKDEKNGDITEDELRSGTEDVQKATDNSIKEIDQMIADKEKDIMSV

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACY_B_2(1DD5)
RRF_THEMA
[Raw transfer]




ACY_B_2(1DD5)
RRF_THEMA
[Raw transfer]




ACY_B_2(1DD5)
RRF_THEMA
[Raw transfer]




1 PsiBlast_PDB 90.7862% -79 - C4 -4GFQ - RRF_BACAN -
4 PsiBlast_PDB 85.2247% -76 - C4 -1WQG - RRF_MYCTU -
6 PsiBlast_PDB 85.1447% -76 - C4 -4KDD - RRF_MYCTU -
2 PsiBlast_PDB 84.7948% -71 - C4 -4KAW - RRF_MYCTU -
22 HHSearch 84.7246% -62 - C4 -1IS1 - RRF_VIBPA -
7 PsiBlast_PDB 84.5847% -72 - C4 -4KB2 - RRF_MYCTU -
13 PsiBlast_PDB 84.4747% -65 - C4 -1IS1 - RRF_VIBPA -
8 PsiBlast_PDB 83.1847% -69 - C4 -4KB4 - RRF_MYCTU -
3 PsiBlast_PDB 83.0547% -71 - C4 -1WQF - RRF_MYCTU -
39 Fugue 82.3445% -69 - C4 -1EK8 - RRF_ECOLI -
10 PsiBlast_PDB 82.3245% -68 - C4 -1EK8 - RRF_ECOLI -
21 HHSearch 82.1545% -62 - C4 -1ISE - RRF_ECOLI -
14 PsiBlast_PDB 82.1545% -62 - C4 -1ISE - RRF_ECOLI -
23 HHSearch 81.7642% -59 - C4 -1EH1 - RRF_THET8 -
15 PsiBlast_PDB 81.7642% -59 - C4 -1EH1 - RRF_THET8 -
16 PsiBlast_PDB 81.6842% -64 - C4 -3J0D - RRF_THET8 -
9 PsiBlast_PDB 80.8548% -66 - C4 -4KC6 - RRF_MYCTU -
5 PsiBlast_PDB 80.3247% -64 - C4 -1WQH - RRF_MYCTU -
24 HHSearch 78.0842% -66 - C4 -1DD5 3.2 RRF_THEMA
40 Fugue 77.8141% -66 - C4 -1DD5 3.2 RRF_THEMA
18 PsiBlast_PDB 77.1742% -69 - C4 -1DD5 3.2 RRF_THEMA