@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA1542: (2016-03-26 )
MTLNKLKDELQIVSHRGLPSDFPENTMVGYREVMGLNVAMLEIDVHLTKDQHFVVIHDETIDRTSDGKGRIADYTLSQLKSFDFGSYKDVAFKGERIPTLDEVLSLCLKYDKKLLIELKSPNLYPEIECKLLAFLEEKKVDATQVVIQSFDIECIEKLNTLGSIYELGVLSSKRNYWYKKPNFSRIAQIASYVNPNYALVARKFVDKAHHHQLQVMPYTVNKLKTGEKLRQMGVDGLITDNPKLFIK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CIT_A_2(3CH0)
?
[Raw transfer]




UNL_A_7(3L12)
?
[Raw transfer]




GOL_A_4(2PZ0)
?
[Raw transfer]




GOL_A_4(2PZ0)
?
[Raw transfer]




GOL_B_6(2PZ0)
?
[Raw transfer]




G3P_A_5(3QVQ)
?
[Raw transfer]




4 PsiBlast_PDB 93.5829% -98 - C3 -4R7O - ? -
58 HHSearch 90.2733% -86 * C3 *2PZ0 2.6 ?
31 PsiBlast_CBE 89.3233% -77 - C3 -2OOG - ? -
2 PsiBlast_PDB 89.2833% -77 - C3 -2OOG - ? -
32 PsiBlast_CBE 88.8233% -75 - C3 -2OOG - ? -
30 PsiBlast_CBE 88.2133% -75 - C3 -2OOG - ? -
21 PsiBlast_CBE 88.2035% -85 - C3 -2PZ0 2.9 ?
25 PsiBlast_CBE 88.0633% -75 - C3 -2P76 - ? -
33 PsiBlast_CBE 88.0133% -74 - C3 -2OOG - ? -
24 PsiBlast_CBE 88.0133% -75 - C3 -2P76 - ? -
3 PsiBlast_PDB 88.0033% -75 - C3 -2P76 - ? -
22 PsiBlast_CBE 87.9633% -75 - C3 -2P76 - ? -
23 PsiBlast_CBE 87.9433% -75 - C3 -2P76 - ? -
28 PsiBlast_CBE 87.9333% -74 - C3 -2P76 - ? -
29 PsiBlast_CBE 87.8633% -76 - C3 -2OOG - ? -
1 PsiBlast_PDB 87.6535% -82 - C3 -2PZ0 2.6 ?
26 PsiBlast_CBE 87.5833% -75 - C3 -2P76 - ? -
27 PsiBlast_CBE 87.5433% -74 - C3 -2P76 - ? -
57 HHSearch 86.8832% -78 - C3 -2OOG - ? -
65 HHSearch 84.9927% -84 - C3 -1YDY - GLPQ_ECOLI -