@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA2060: (2016-03-31 )
MLSQEFFNSFITIYRPYLKLAEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEAHND

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAL_B_2(4EM0)
Y2349_STAAR
[Raw transfer]



SAL_A_4(4EM2)
Y2349_STAAR
[Raw transfer]
3 PsiBlast_PDB 96.9199%-127 - C1 -4EM2 2.9 Y2349_STAAR
2 PsiBlast_PDB 94.9699%-138 - C1 -4EM1 - Y2349_STAAR -
1 PsiBlast_PDB 94.0199%-122 - C1 -4EM0 3.5 Y2349_STAAR
19 PsiBlast_PDB 66.8723%-119 - C1 -3GFL - ? -
43 HHSearch 65.9619%-121 - C1 -3DEU - SLYA_SALTY -
41 HHSearch 65.2316%-119 - C1 -2FBI - ? -
35 HHSearch 65.2221%-116 - C1 -2GXG - ? -
39 HHSearch 64.3218%-110 - C1 -2RDP - ? -
36 HHSearch 63.7017%-102 - C1 -3G3Z - ? -
37 HHSearch 62.8518%-104 * C1 *3S2W - ? -
47 Fugue 62.6722%-105 - C1 -2FBH - ? -
15 PsiBlast_PDB 62.0522%-125 - C1 -3DEU - SLYA_SALTY -
49 Fugue 61.3415%-109 - C1 -1JGS - MARR_ECOLI -
33 HHSearch 61.3421%-105 - C1 -2FBH - ? -
42 HHSearch 61.2614%-107 - C1 -3CJN - ? -
45 Fugue 61.0916% -99 - C1 -1LJ9 - ? -
34 HHSearch 61.0519%-107 - C1 -2FA5 - ? -
38 HHSearch 60.1416% -97 - C1 -3BRO - ? -
29 HHSearch 60.1419% -98 - C1 -2A61 - ? -
6 PsiBlast_PDB 59.9225%-100 - C1 -2BV6 - MGRA_STAAU -