@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA2458: (2016-04-04 )
MKDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFDYLNNIIMMNQNKSNYSIDALYQFLFEFIFDIEERYIRMYVQLSNTPEEFSGNIYGQIQDLNQSLSKEIAKFYDESKIKMTKEDFQNLILLFLESWYLKASFSQKFGAVEESKSQFKDEVYSLLNIFLKK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMT_B_12(3GEU)
ICAR_STAAC
[Raw transfer]
22 PsiBlast_CBE 94.7997%-132 - C1 -3GEU - ICAR_STAAC -
21 PsiBlast_CBE 94.6797%-133 - C1 -3GEU - ICAR_STAAC -
1 PsiBlast_PDB 94.6797%-126 - C1 -3GEU - ICAR_STAAC -
23 PsiBlast_CBE 94.2497%-132 - C1 -3GEU 3.0 ICAR_STAAC
2 PsiBlast_PDB 87.5365%-134 - C1 -2ZCN - ICAR_STAEQ -
114 Fugue 86.5665%-129 - C1 -2ZCN - ICAR_STAEQ -
117 Fugue 52.4812% -79 - C1 -1T56 - ETHR_MYCTU -
3 PsiBlast_PDB 52.2564% -38 - C1 -2ZCM - ICAR_STAEQ -
116 Fugue 44.6815% -80 - C1 -1ZKG - ? -
123 Fugue 41.7117% -59 - C1 -1JT6 - QACR_STAAU -
119 Fugue 40.1012% -68 - C1 -2UXU - TTGR_PSEPT -
96 PsiBlast_CBE 39.9341% -70 - C1 -2GBY - QACR_STAAU -
27 PsiBlast_CBE 39.0539% -90 - C1 -3RH2 - ? -
108 PsiBlast_CBE 38.9041% -77 - C1 -1RKW - QACR_STAAU -
97 PsiBlast_CBE 38.7141% -78 - C1 -2G0E - QACR_STAHA -
13 PsiBlast_PDB 38.6728% -55 - C1 -4I76 - ? -
12 PsiBlast_PDB 38.4528% -62 - C1 -4I6Z - ? -
7 PsiBlast_PDB 38.3328% -55 - C1 -2IEK - ? -
8 PsiBlast_PDB 38.1428% -56 - C1 -2ID6 - ? -
136 HHSearch 38.1330% -71 - C1 -3VPR - ? -