@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0868: (2015-12-19 )
MKLPVVESFFSLQGEGKRIGKPSLFLRLGGCNLSCKGFNCKTLFNDEILTGCDSLYAVHPKFKTSWDYYNEPKPLIERLVNLAPNYKDFDFILTGGEPSLYFNNPILLSVLEHFYHKKIPLFVESNGSIFFEFSPILKELHFTLSVKLSFSLEQESKRINLKALQNILNNAKSVHFKFVLESQNAAHSIAEIQSLLKQLSLKNNEIFLMPLGTTNNELDKNLKTLAPLAIEHGFRLSDRLHIRLWDNKKGF

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2K8_A_5(4NJH)
?
[Raw transfer]




SF4_A_3(4NJH)
?
[Raw transfer]




43 Fugue 83.9725% -71 - C7 -4NJH 4.1 ?
30 HHSearch 74.1716% -84 - C7 -3RFA - RLMN_ECOLI -
1 PsiBlast_PDB 71.8427% -90 - C7 -4NJG - ? -
5 PsiBlast_PDB 71.6727% -90 - C7 -4NJK - ? -
3 PsiBlast_PDB 71.2627% -91 - C7 -4NJI - ? -
2 PsiBlast_PDB 70.6727% -89 - C7 -4NJH - ? -
4 PsiBlast_PDB 69.7027% -94 - C7 -4NJJ - ? -
29 HHSearch 64.6918%-111 - C7 -2Z2U - TYW1_METJA -
45 Fugue 62.8716% -57 - C7 -1TV8 - MOAA_STAA8 -
44 Fugue 62.1513% -74 - C7 -3C8F - PFLA_ECOLI -
47 Fugue 60.0719% -50 * C4 *4QB7 - ? -
52 Fugue 56.1719% -53 - C1 -4RGL - ? -
32 HHSearch 53.5614% -64 - C7 -2A5H - KAMA_CLOSU -
28 HHSearch 53.3914% -62 * C7 *1TV8 - MOAA_STAA8 -
46 Fugue 50.9816% -36 * C6 *4P4M - ? -
51 Fugue 50.2819% -57 - C2 -4UVJ - SCC3_YEAST -
50 Fugue 48.6925% -91 - C6 -1P68 - ? -
31 HHSearch 48.4517% -77 - C7 -2YX0 - TYW1_PYRHO -
35 HHSearch 46.8112% -79 - C7 -2QGQ - RIMO_THEMA -
37 HHSearch 45.3910% -83 - C7 -3T7V - PYLB_METBF -