@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1005: (2016-03-20 )
MEKIGFVGTGVMGSSMAGHLLEAGYEVLVYTRTKTKAEDLLDKGALWVETPGELANKVDILISMVGYPKDVEELYLGENGFLENLAVGTVAIDMTTSSPALAKKMAEFGREKGIGVLDAPVSGGDIGAKNGTLSIMVGGSEDVFLKVKPIFDILGSSVILQGDAGAGQHTKMVNQIAIASNMIGVTEAIIYAEAAGLNPSRVLDSISGGAAGSWSLANLIPRVLKDDFSPGFFIKHFIKDMGIAISEAKQMGLELPGLTLAEKMYQTLAEQGLSEEGTQALIKYYR

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EPE_A_6(3OBB)
SERDH_PSEAE
[Raw transfer]




EPE_A_6(3OBB)
SERDH_PSEAE
[Raw transfer]




NAP_A_2(3WS7)
?
[Raw transfer]




TLA_A_3(1VPD)
?
[Raw transfer]




63 HHSearch 96.7941%-105 - C1 -3WS7 12.2 ?
59 HHSearch 95.4538%-105 - C1 -1VPD 2.8 ?
1 PsiBlast_PDB 95.1641%-107 - C1 -3WS7 - ? -
5 PsiBlast_PDB 93.7836%-107 - C1 -1VPD - ? -
2 PsiBlast_PDB 93.5540%-105 - C1 -3W6Z - ? -
55 HHSearch 90.8329%-104 - C1 -3PDU - ? -
27 PsiBlast_CBE 90.1631%-107 - C1 -3PEF - ? -
75 Fugue 89.7129%-107 - C1 -3DOJ - GLYR1_ARATH -
57 HHSearch 89.5131%-104 - C1 -3PEF - ? -
26 PsiBlast_CBE 89.4531%-105 - C1 -3PEF - ? -
7 PsiBlast_PDB 89.2331%-105 - C1 -3PEF - ? -
30 PsiBlast_CBE 89.1731%-103 - C1 -3PEF - ? -
24 PsiBlast_CBE 89.1131%-105 - C1 -3PEF - ? -
62 HHSearch 89.0829%-107 - C1 -3DOJ - GLYR1_ARATH -
28 PsiBlast_CBE 88.8631%-103 - C1 -3PEF - ? -
10 PsiBlast_PDB 88.6529%-107 - C1 -3DOJ - GLYR1_ARATH -
61 HHSearch 88.3829%-107 - C1 -3G0O - ? -
11 PsiBlast_PDB 88.1128%-103 - C1 -3PDU - ? -
64 HHSearch 87.8927%-106 * C1 *2UYY - GLYR1_HUMAN -
29 PsiBlast_CBE 87.8631%-104 - C1 -3PEF - ? -
56 HHSearch 86.8234%-105 - C1 -3OBB 2.5 SERDH_PSEAE
17 PsiBlast_PDB 84.8032%-107 - C1 -3OBB 2.5 SERDH_PSEAE