@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0277: (2015-11-29 )
MTFFKKLKKIFLDYVIHIRDRRSPQKNRERVGQNLMILTIFLFFIFIINFVIIVGTDSKFGVNLSKEAKKVYQQSMTVQAKRGTIYDRNGNPIAEDATTYSLYAIISKNYTTATGQKLYVQPSQYEKVASILENKLGMKKNLVLKQLNQKKLFQVSFGSSGSGLSYTKMADIKKTMEKSDIKGIGFSTSPGRIYPNGIFASQFIGFTLPQDDGDGKKLVGNTGLEAALNKVLSGTDGKVTYEKDRSGNVLLGTATTERRAVNGKDIYTTLSEPIQTVLETQMDVFAEKTKGKFASATVVNAKTGEILATSQRPTYNPSTLKGYDKKNLGTYNTLLYDNFFEPGSTMKVMTLASAIDSKHFNSTEVYNSAQYKIADAVIRDWDVNEGLSSGSYMTFPQGFAHSSNVGMVTLEQKMGRDKWLNYLSKFKFGYPTRFGMLHESGGLFPSDNEVTIAMSSFGQGIGVTQVQMLRAFTSISNDGVMLQPQFISSIYDPNTGTSRTARKEVVGKPISKEAASKTRDYMVTVGTDPYYGTLYAAGAPVIQVGNQSVAVKSGTAQIAQEGGGGYLQGKNDTINSVVAMVPSENPDFIMYVTIQQPEKFSITFWKDVVNPVLEQATAMKETILKPGLNDSEHQTKYKLSKIVGENPGHVAEELRRNLVQPIILGNGSKVSKVSKRPGANLAENEQLLVLTNKLTELPDMYGWSKANVEQFAKWTGIKVTYKGSTSGKVRKQSIDVGKSINKIKKIKITIGD

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CDS_E_9(2Z2M)
?
[Raw transfer]



CDS_B_8(2Z2M)
?
[Raw transfer]



BMG_B_8(2ZC3)
?
[Raw transfer]



TEB_B_8(2ZC4)
?
[Raw transfer]



BMG_E_9(2ZC3)
?
[Raw transfer]



TEB_E_9(2ZC4)
?
[Raw transfer]
1 PsiBlast_PDB 91.1355% -61 - C1 -1RP5 - PBPX_STRPN -
57 Fugue 90.4758% -56 - C1 -1QME - PBPX_STRPN -
56 Fugue 90.2157% -56 - C1 -1QME - PBPX_STRPN -
2 PsiBlast_PDB 89.9455% -57 - C1 -1QME - PBPX_STRPN -
21 PsiBlast_CBE 89.6655% -60 - C1 -1RP5 - PBPX_STRPN -
27 HHSearch 88.1155% -55 - C1 -1QME - PBPX_STRPN -
3 PsiBlast_PDB 87.8054% -58 - C1 -1PYY - PBPX_STRR6 -
58 Fugue 83.5754% -47 - C1 -1K25 - ? -
59 Fugue 70.4260% -69 - C1 -1QME - PBPX_STRPN -
22 PsiBlast_CBE 66.9159% -72 - C1 -2ZC4 4.3 ?
6 PsiBlast_PDB 66.2659% -67 - C1 -2Z2M 5.6 ?
7 PsiBlast_PDB 66.1659% -69 - C1 -2ZC3 4.3 ?
23 PsiBlast_CBE 66.1259% -69 - C1 -2ZC3 4.1 ?
5 PsiBlast_PDB 65.9459% -65 - C1 -2Z2L - ? -
24 PsiBlast_CBE 65.6959% -71 - C1 -2Z2M 4.2 ?
8 PsiBlast_PDB 65.6459% -67 - C1 -2ZC4 3.2 ?
30 HHSearch 60.6725% -47 * C1 *3EQU - PBP2_NEIGO -
60 Fugue 59.8625% -48 - C1 -3OC2 - ? -
10 PsiBlast_PDB 58.9528% -39 - C1 -3EQU - PBP2_NEIGO -
9 PsiBlast_PDB 58.7229% -39 - C1 -3EQV - PBP2_NEIGO -