@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0281: (2015-11-29 )
MNQFILTGGWSWYNNLVSQVPAGKLFSWKAVLDAIPSILERLPITLLLTVAGALFGLILALIFAVVKINRVKILYPIQALFVSFLRGTPILVQLMLSYYGIPLFLKFLNQKYGFDWNINAIPASVFAITAFAFNEAAYTSETIRAAILSVDQGEIEAARSLGMTSAQVYRRVIIPNAAVVATPTLINTLIGLTKGTSLAFNAGIVEMFAQAQIMGGSDYRYFERYISVALVYWAVSFLIEQLGNAIERKMAIKAPRHLTDEIPGGVR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ARG_C_10(4YMU)
?
[Raw transfer]




ARG_C_10(4YMU)
?
[Raw transfer]




25 Fugue 89.5735%-118 - C4 -4YMU 3.7 ?
14 PsiBlast_CBE 88.0135%-126 - C4 -4YMT - ? -
12 PsiBlast_CBE 87.4635%-124 - C4 -4YMW - ? -
1 PsiBlast_PDB 87.2235%-126 - C4 -4YMS - ? -
4 PsiBlast_PDB 87.1935%-124 - C4 -4YMV - ? -
13 PsiBlast_CBE 87.1435%-125 - C4 -4YMU 3.7 ?
5 PsiBlast_PDB 87.1435%-124 - C4 -4YMW - ? -
3 PsiBlast_PDB 86.5735%-128 - C4 -4YMU - ? -
2 PsiBlast_PDB 86.2435%-125 - C4 -4YMT - ? -
15 HHSearch 70.0821%-121 - C4 -3TUI - METI_ECOLI -
26 Fugue 66.3315% -98 - C4 -2ONK - WTPB_ARCFU -
27 Fugue 65.7821%-106 - C4 -3DHW - METI_ECOLI -
16 HHSearch 62.3814%-114 - C4 -3D31 - ? -
28 Fugue 62.1922%-119 * C3 *4KKI - TCO1_HUMAN -
30 Fugue 60.1920%-136 - C1 -4KYI - ? -
17 HHSearch 59.3013%-111 * C4 *2ONK - WTPB_ARCFU -
31 Fugue 57.9517% -95 - C3 -2VQ2 - ? -
29 Fugue 56.9018% -90 - C2 -1Q9J - PAPA5_MYCTU -
18 HHSearch 47.6610%-104 - C4 -3RLF - MALF_ECOLI -
10 PsiBlast_PDB 47.2028%-141 - C4 -4TQU - ? -