@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0438: (2015-11-30 )
MEKKLLRKEVLITLKSQPQAYKSEVDCKLLEAFIKTKAYQNSCVIATYLSFDYEYNTQLLIKQALCDGKRVLVPKTYPKGKMIFVDYQKDNLRATPFGLLEPVNDRAVEKASIDLIHVPGLIFNNKGFRIGYGAGYFDRYLSDFEGDTISTIYRCQRQDFVEEKHDVAVKEVLCL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_3(2JCB)
?
[Raw transfer]




22 HHSearch 96.7236%-105 - C8 -1YDM - YQGN_BACSU -
23 HHSearch 93.4432%-101 - C8 -2JCB 5.8 ?
7 PsiBlast_PDB 91.3228% -91 - C8 -3HY6 - MTHFS_HUMAN -
5 PsiBlast_PDB 90.7428% -90 - C8 -3HY3 - MTHFS_HUMAN -
24 HHSearch 90.6028% -95 - C8 -3HY3 - MTHFS_HUMAN -
6 PsiBlast_PDB 89.9128% -96 - C8 -3HY4 - MTHFS_HUMAN -
3 PsiBlast_PDB 89.1333% -99 - C8 -2JCB - ? -
4 PsiBlast_PDB 88.4428% -93 - C8 -3HXT - MTHFS_HUMAN -
21 PsiBlast_CBE 88.3233% -97 - C8 -2JCB - ? -
1 PsiBlast_PDB 87.4241% -93 - C8 -1YDM - YQGN_BACSU -
25 HHSearch 85.5026% -82 - C8 -1SOU - ? -
36 Fugue 83.9525% -79 * C8 *1SOU - ? -
9 PsiBlast_PDB 81.7125%-102 - C8 -1SBQ - MTHFS_MYCPN -
10 PsiBlast_PDB 81.2725%-103 - C8 -1U3F - MTHFS_MYCPN -
11 PsiBlast_PDB 80.9325%-101 - C8 -1U3G - MTHFS_MYCPN -
2 PsiBlast_PDB 80.6826% -85 - C8 -1SOU - ? -
27 HHSearch 77.3425% -73 - C8 -1SBQ - MTHFS_MYCPN -
26 HHSearch 76.3624% -64 - C8 -1WKC - ? -
8 PsiBlast_PDB 70.3627% -67 - C8 -1WKC - ? -
38 Fugue 57.8419% -71 - C8 -4E8Y - ? -