@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0443: (2015-12-01 )
MKKTYRVKSDKDFQMIFSRGKNVANRKFVIYYLEKEQKHFRVGISVSKKLGNAVVRNAIKRKIRHVLLSQKTALQDYDFVVIARKGVEELNYQALEKNLIHVLKIAGLI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PPV_A_4(4JG4)
RNPA_BACSU
[Raw transfer]
1 PsiBlast_PDB 93.4147%-122 - C3 -4JG4 3.1 RNPA_BACSU
27 Fugue 92.3648%-117 - C3 -1D6T - RNPA_STAAU -
2 PsiBlast_PDB 92.1147%-115 - C3 -1A6F - RNPA_BACSU -
3 PsiBlast_PDB 90.2649%-108 - C3 -1D6T - RNPA_STAAU -
18 HHSearch 89.8148%-113 - C3 -1D6T - RNPA_STAAU -
7 PsiBlast_PDB 80.4030%-103 - C3 -2LJP - RNPA_ECOLI -
19 HHSearch 80.1130%-138 * C3 *1NZ0 - RNPA_THEMA -
20 HHSearch 78.6628%-112 - C3 -2LJP - RNPA_ECOLI -
4 PsiBlast_PDB 76.5631%-144 - C3 -1NZ0 - RNPA_THEMA -
6 PsiBlast_PDB 76.3731%-149 - C3 -3Q1R - RNPA_THEMA -
5 PsiBlast_PDB 76.2231%-149 - C3 -3Q1Q - RNPA_THEMA -
33 Fugue 45.0413% -55 - C3 -2ABY - ? -
9 PsiBlast_PDB 43.3330% -74 - C3 -2VV5 - MSCS_ECOLI -
34 Fugue 42.0615% -71 - C1 -2KKU - ? -
10 PsiBlast_PDB 41.8330% -67 - C3 -4AGF - MSCS_ECOLI -
12 PsiBlast_PDB 41.8230% -54 - C3 -4HWA - MSCS_ECOLI -
11 PsiBlast_PDB 39.8430% -50 - C3 -2OAU - MSCS_ECOLI -
8 PsiBlast_PDB 36.3224% -44 - C3 -5C3L - ? -
31 Fugue 34.559% -46 - C3 -1PQX - ? -
24 HHSearch 33.0438% -66 - C3 -3R3T - RS6_BACAN -