@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0515: (2015-12-01 )
MLSKAKSRYIIREIIKLFPDAKPSLDFTNVFELLVAVMLSAQTTDAAVNKVTPALFERFPNPLVLAQADPKEIEPYISKIGLYRNKARFLNQCAKQLIEHFDGKVPQTRQELESLSGVGRKTANVVMSVGFGIPAFAVDTHVTRICKHHQICKQSASPLEIEKRVMEVLPPEEWLAAHQSMIYFGRAICHPKNPKCDQYPQLYHFPDNLK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_B_1(1P59)
?
[Raw transfer]

-

NACID_B_1(1ORP)
?
[Raw transfer]

-

NACID_B_1(1ORN)
?
[Raw transfer]

-

NACID_B_1(1ORN)
?
[Raw transfer]

-

1 PsiBlast_PDB 96.9450%-134 - C2 -1ORN 7.5 ?
21 HHSearch 96.8449%-130 - C2 -1ORN 7.5 ?
3 PsiBlast_PDB 96.2949%-129 - C2 -1P59 6.0 ?
2 PsiBlast_PDB 94.7550%-135 - C2 -1ORP 5.0 ?
22 HHSearch 83.8036%-122 - C2 -2ABK - END3_ECOLI -
4 PsiBlast_PDB 82.1837%-121 - C2 -2ABK - END3_ECOLI -
46 Fugue 79.5625%-114 - C2 -1RRQ - ? -
24 HHSearch 78.4422%-113 - C2 -3N5N - MUTYH_HUMAN -
9 PsiBlast_PDB 78.4325%-120 - C2 -1RRQ - ? -
23 HHSearch 78.0321%-112 - C2 -1KEA - GTMR_METTF -
12 PsiBlast_PDB 77.9525%-125 - C2 -1VRL - ? -
10 PsiBlast_PDB 76.5225%-116 - C2 -4YPR - ? -
5 PsiBlast_PDB 76.0726%-123 - C2 -3G0Q - ? -
8 PsiBlast_PDB 75.9826%-123 - C2 -3FSP - ? -
6 PsiBlast_PDB 75.8426%-121 - C2 -4YOQ - ? -
26 HHSearch 75.7425%-112 - C2 -3FSP - ? -
7 PsiBlast_PDB 75.0426%-121 - C2 -4YPH - ? -
11 PsiBlast_PDB 74.4725%-122 - C2 -1RRS - ? -
13 PsiBlast_PDB 74.1326%-126 - C2 -3N5N - MUTYH_HUMAN -
20 PsiBlast_PDB 74.0030%-116 - C2 -1KG5 - MUTY_ECOLI -