@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0548: (2015-12-01 )
MSKIKIVTDSSITIEPELIKELDITVVPLSVMIDGTLYSDNDLKAQGEFLNLMRGSKELPKTSQPPVGVFAEIYEKLMNEGAEHIIAIHLTHTLSGTIEASRQGANIAGADVTVIDSTFTDQCQKFQVVEAAKLAKEGADLDTILARVEEVRQKSELFIGVSTLENLVKGGRIGRVTGLLSSLLNIKVIMELTNHELVPIVKGRGLKTFSKWLDNFVESAQTRKIAEIGISYCGKADMANNFKEKLAVLGAPISVLETGSIIQTHTGEDAFAVMVRYE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HXA_A_20(2G7Z)
Y1493_STRP1
[Raw transfer]




HXA_A_20(2G7Z)
Y1493_STRP1
[Raw transfer]




GOL_A_24(2G7Z)
Y1493_STRP1
[Raw transfer]




1 PsiBlast_PDB 99.5469%-111 - C4 -2G7Z 7.3 Y1493_STRP1
17 HHSearch 96.8969%-102 - C4 -2G7Z 7.3 Y1493_STRP1
2 PsiBlast_PDB 77.5630% -95 - C4 -2DT8 - ? -
14 HHSearch 77.5430% -92 - C4 -2DT8 - ? -
6 PsiBlast_PDB 74.6927% -91 - C4 -3LUP - ? -
16 HHSearch 73.2126% -95 - C4 -3LUP - ? -
23 HHSearch 72.4826% -87 - C4 -3PL5 - ? -
19 HHSearch 72.0428% -87 - C4 -3FYS - DEGV_BACSU -
15 HHSearch 71.9525% -86 - C4 -1PZX - ? -
8 PsiBlast_PDB 71.5825% -92 - C4 -1PZX - ? -
22 HHSearch 70.8723% -80 - C4 -3JR7 - ? -
3 PsiBlast_PDB 70.5028% -87 - C4 -3FYS - DEGV_BACSU -
7 PsiBlast_PDB 69.7927% -80 - C4 -3PL5 - ? -
21 HHSearch 67.9220% -74 - C4 -3FDJ - ? -
18 HHSearch 66.7521% -81 - C4 -3NYI - ? -
20 HHSearch 65.5123% -81 - C4 -1MGP - Y1468_THEMA -
4 PsiBlast_PDB 61.5328% -69 - C4 -1VPV - Y1468_THEMA -
5 PsiBlast_PDB 60.9628% -63 - C4 -1MGP - Y1468_THEMA -
11 PsiBlast_PDB 57.1623% -83 - C4 -3FDJ - ? -
9 PsiBlast_PDB 56.9425% -92 - C4 -3NYI - ? -