@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0575: (2015-12-02 )
MLYEVTSSNTQGVDGKVYLSNGKIVETNHPLNHLPGFNPEELIALAWSTCLNATIKAILEQKGFKDLKSRVDVTCQLMKEKQVGKGFYFQVNAVASIEKLSLSDSKLIVNKAHSRCPISKLISNAKTINLDTVKWSV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_B_12(2QL8)
?
[Raw transfer]



BEZ_A_3(2QL8)
?
[Raw transfer]
36 HHSearch 93.3633% -85 - C1 -2QL8 3.0 ?
1 PsiBlast_PDB 91.3032% -94 - C1 -2QL8 2.8 ?
10 PsiBlast_PDB 84.5226% -94 - C1 -3EER - ? -
9 PsiBlast_PDB 84.3026%-109 - C1 -3I07 - ? -
45 HHSearch 84.1422% -84 - C1 -1N2F - ? -
40 HHSearch 83.5621% -87 - C1 -1USP - ? -
11 PsiBlast_PDB 82.8826%-103 - C1 -3LUS - ? -
53 Fugue 79.4223% -66 - C1 -1N2F - ? -
39 HHSearch 79.2321% -93 - C1 -3EER - ? -
38 HHSearch 78.3020% -82 * C1 *2ONF - ? -
35 HHSearch 78.1920% -78 - C1 -2BJO - OHRB_BACSU -
8 PsiBlast_PDB 77.7926% -69 - C1 -1N2F - ? -
3 PsiBlast_PDB 77.3128%-116 - C1 -2BJO - OHRB_BACSU -
4 PsiBlast_PDB 74.0228% -99 - C1 -1NYE - OSMC_ECOLI -
55 Fugue 73.9116% -74 - C1 -1LQL - HPRR_MYCPN -
49 HHSearch 73.1619% -84 - C1 -1NYE - OSMC_ECOLI -
56 Fugue 72.8319% -75 - C1 -1NYE - OSMC_ECOLI -
6 PsiBlast_PDB 69.1923%-109 - C1 -1USP - ? -
43 HHSearch 66.2416% -70 - C1 -1LQL - HPRR_MYCPN -
7 PsiBlast_PDB 65.4524% -31 - C1 -4NOZ - ? -