@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0767: (2015-12-03 )
MMKKEDYMALALKEAEKGMGFVAPNPLVGAVIVKDDRIISKGYHKRFGDLHAERQAIKNADEDISGSTLYVTLEPCCHVGKQPPCTEALIKSGIKKVVVGSLDPNPLVSGKGIALLRKECLNVEVGILREECDALNERFIFHMTYKQPFVYLKYAMTLDGKIATKTGDSKWISNEHSRQSVQKLRQKCSAIMVGINTVLADNPRLTCRIPKGEALVRIVCDSQLKIPLDSYLVKSAKTIPTWIATCSDNLAQQQTLKEMGCRLIKVPRKDGKLDLKVLMTILGQEGIDSLLIEGGSSLHFSALKAGIVNRLIVFIAPKIIGGLKAKTAISGEGLDWLNQDFRVKDIELSRMDSDVVIEGKVEHYVYRNY

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_10(2B3J)
TADA_STAAM
[Raw transfer]
21 PsiBlast_CBE 91.8041%-102 - C3 -4G3M - RIBD_BACSU -
24 PsiBlast_CBE 91.7341%-105 - C3 -3EX8 - RIBD_BACSU -
30 PsiBlast_CBE 91.6841%-103 - C3 -2B3Z - RIBD_BACSU -
31 PsiBlast_CBE 91.3941%-102 - C3 -2B3Z - RIBD_BACSU -
27 PsiBlast_CBE 90.9741%-103 - C3 -2D5N - RIBD_BACSU -
4 PsiBlast_PDB 90.8841% -99 - C3 -4G3M - RIBD_BACSU -
23 PsiBlast_CBE 90.8141% -93 - C3 -4G3M - RIBD_BACSU -
22 PsiBlast_CBE 90.8041% -98 - C3 -4G3M - RIBD_BACSU -
28 PsiBlast_CBE 90.5841%-101 - C3 -2D5N - RIBD_BACSU -
29 PsiBlast_CBE 90.5341%-101 - C3 -2D5N - RIBD_BACSU -
2 PsiBlast_PDB 90.1641% -99 - C3 -2D5N - RIBD_BACSU -
32 PsiBlast_CBE 90.0441% -99 - C3 -2B3Z - RIBD_BACSU -
26 PsiBlast_CBE 90.0441% -99 - C3 -3EX8 - RIBD_BACSU -
50 HHSearch 90.0242% -96 - C3 -2B3Z - RIBD_BACSU -
25 PsiBlast_CBE 89.7341%-101 - C3 -3EX8 - RIBD_BACSU -
1 PsiBlast_PDB 89.3841% -96 - C3 -2B3Z - RIBD_BACSU -
3 PsiBlast_PDB 88.9241% -96 - C3 -3EX8 - RIBD_BACSU -
71 Fugue 87.9840% -92 - C3 -2B3Z - RIBD_BACSU -
52 HHSearch 81.7941% -91 * C3 *2HXV - ? -
6 PsiBlast_PDB 79.1135% -98 - C3 -3ZPC - ? -
55 HHSearch 46.1536% -70 - C3 -2B3J 3.0 TADA_STAAM