@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0768: (2015-12-03 )
MFTGIIEEMGQVSRIRNGIKSQQLSIDAPKLVPLLRKGDSVAVNGVCLTVLDKSETAFIADVMPESMMRTSLAALRLHSKVNLELALRSDSRLGGHFVLGHVDGVGKIEKIQKDDIAVRFSIDAPPSIMSYIIEKGSVALDGISLTVVSFTEHSFEVSVIPHTMAQTNLSLKKVGDLLNIEVDVLGKYAEKFLAPTNRTNHTSSVMDWSFLSENGY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CRM_A_4(1KZL)
RISA_SCHPO
[Raw transfer]




CRM_A_4(1KZL)
RISA_SCHPO
[Raw transfer]




CRM_A_4(1KZL)
RISA_SCHPO
[Raw transfer]




INI_B_7(4GQN)
?
[Raw transfer]




1 PsiBlast_PDB 94.4838% -97 - C3 -1KZL 5.9 RISA_SCHPO
38 HHSearch 94.2239% -90 - C3 -1KZL 6.0 RISA_SCHPO
3 PsiBlast_PDB 92.4637%-103 - C3 -4FXU - ? -
4 PsiBlast_PDB 91.4637% -97 - C3 -4G6I - ? -
5 PsiBlast_PDB 91.2737%-100 - C3 -4GQN 2.5 ?
24 PsiBlast_CBE 91.0337% -98 - C3 -4G6I - ? -
25 PsiBlast_CBE 90.7737% -95 - C3 -4E0F - ? -
22 PsiBlast_CBE 90.7637% -98 - C3 -4GQN - ? -
2 PsiBlast_PDB 89.9637% -97 - C3 -4E0F - ? -
21 PsiBlast_CBE 88.9037% -96 - C3 -4GQN - ? -
23 PsiBlast_CBE 88.7337% -93 - C3 -4G6I - ? -
6 PsiBlast_PDB 87.5933% -97 - C3 -1I8D - RISA_ECOLI -
39 HHSearch 87.0931% -83 - C3 -1I8D - RISA_ECOLI -
51 Fugue 87.0630% -82 - C3 -1I8D - RISA_ECOLI -
40 HHSearch 70.8724% -91 - C3 -3A35 - ? -
41 HHSearch 70.2623% -72 - C3 -3DDY - LUXP_PHOLE -
7 PsiBlast_PDB 69.9024% -90 - C3 -3A35 - ? -
8 PsiBlast_PDB 69.8224% -83 - C3 -3A3B - ? -
52 Fugue 69.0739%-105 * C3 *1KZL 2.4 RISA_SCHPO
9 PsiBlast_PDB 63.5024% -76 - C3 -3DDY - LUXP_PHOLE -