@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0773: (2015-12-03 )
MKFYLVRHGKTQWNLEGRFQGANGDSPLLEEAIEELEELGQYLSSIHFDAVYSSDLGRARDTVNILNDANSCPKEIHYTPQLREWALGTLEGCKIATMQAIYPRQMTAFYQNPLQFKHDMFGAESLYQTTHRVESFLRSLASKNYDKVLIVGHGANLTASIRSLLGYQYGSLHYKDKLDNASLTIIETHDFKDFNCLTWNDKSYLRQEVKMTH

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_4(1H2E)
?
[Raw transfer]




EDO_A_4(1H2E)
?
[Raw transfer]




GOL_A_9(1EBB)
?
[Raw transfer]




3 PsiBlast_PDB 87.0829% -72 - C2 -1EBB 2.5 ?
2 PsiBlast_PDB 85.5830% -65 - C2 -1H2F - ? -
68 HHSearch 85.3230% -70 - C2 -1H2E 3.3 ?
1 PsiBlast_PDB 85.3130% -67 * C2 *1H2E 3.3 ?
70 HHSearch 84.5531% -64 - C2 -3R7A - ? -
4 PsiBlast_PDB 81.6728% -68 - C2 -4IJ5 - PSPA_HYDTT -
82 HHSearch 80.9426% -64 - C2 -3D8H - ? -
5 PsiBlast_PDB 80.1127% -69 - C2 -4IJ6 - PSPA_HYDTT -
10 PsiBlast_PDB 79.2331% -65 - C2 -3R7A - ? -
74 HHSearch 78.0626% -64 - C2 -1FZT - PMGY_SCHPO -
71 HHSearch 76.4525% -58 - C2 -3DCY - TIGAR_HUMAN -
77 HHSearch 76.1928% -60 - C2 -3GP3 - GPMA_BURP1 -
80 HHSearch 75.9925% -60 - C2 -3KKK - ? -
69 HHSearch 75.5627% -66 - C2 -3E9C - TIGRB_DANRE -
91 HHSearch 75.3834% -71 - C2 -1V37 - ? -
75 HHSearch 72.3322% -46 - C2 -1QHF - PMG1_YEAST -
85 HHSearch 67.5822% -64 - C2 -1RII - GPMA_MYCTU -
16 PsiBlast_PDB 65.5633% -61 - C2 -1V37 - ? -
8 PsiBlast_PDB 65.1534% -62 - C2 -2P9Z - ? -
41 PsiBlast_CBE 65.0733% -60 - C2 -2ENU - ? -