@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0930: (2015-12-04 )
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINQGYYGMVTGDIFPLDANSVGDTINRGGTFLRSARYPEFAELEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAVGLPGTIDNDIVGTDYTIGFDTAVATAVENLDRLRDTSASHNRTFVVEVMGRNAGDIALWSGIAAGADQIIVPEEEFNIDEVVSNVRAGYAAGKHHQIIVLAEGVMSGDEFAKTMKAAGDDSDLRVTNLGHLLRGGSPTARDRVLASRMGAYAVQLLKEGRGGLAVGVHNEEMVESPILGLAEEGALFSLTDEGKIVVNNPHKADLRLAALNRDLANQSSK

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_9(1PFK)
PFKA_ECOLI
[Raw transfer]



ADP_A_9(1PFK)
PFKA_ECOLI
[Raw transfer]



ADP_B_11(1PFK)
PFKA_ECOLI
[Raw transfer]



F6P_A_2(4PFK)
PFKA_GEOSE
[Raw transfer]
3 PsiBlast_PDB 97.2657%-104 - C6 -3PFK - PFKA_GEOSE -
24 PsiBlast_CBE 97.2457%-105 - C6 -3U39 - PFKA_GEOSE -
4 PsiBlast_PDB 97.0057%-105 - C6 -4PFK 3.0 PFKA_GEOSE
2 PsiBlast_PDB 96.9457%-106 - C6 -3U39 - PFKA_GEOSE -
29 PsiBlast_CBE 96.7857%-105 - C6 -4I4I - PFKA_GEOSE -
10 PsiBlast_PDB 96.7458%-106 - C6 -4A3S - PFKA_BACSU -
12 PsiBlast_PDB 96.7057%-112 - C6 -2PFK - PFKA_ECOLI -
26 PsiBlast_CBE 96.5957%-104 - C6 -3U39 - PFKA_GEOSE -
21 PsiBlast_CBE 96.4757%-103 - C6 -6PFK - PFKA_GEOSE -
8 PsiBlast_PDB 96.3157%-105 - C6 -1MTO - PFKA_GEOSE -
27 PsiBlast_CBE 96.2957%-105 - C6 -4I4I - PFKA_GEOSE -
23 PsiBlast_CBE 96.2757%-102 - C6 -6PFK - PFKA_GEOSE -
1 PsiBlast_PDB 96.1257%-103 - C6 -6PFK - PFKA_GEOSE -
80 HHSearch 96.1154%-103 * C6 *1PFK 6.9 PFKA_ECOLI
28 PsiBlast_CBE 96.0857%-102 - C6 -4I4I - PFKA_GEOSE -
31 PsiBlast_CBE 95.8857%-104 - C6 -4I7E - PFKA_GEOSE -
22 PsiBlast_CBE 95.8357%-106 - C6 -6PFK - PFKA_GEOSE -
9 PsiBlast_PDB 95.8055%-103 - C6 -1ZXX - PFKA_LACDE -
30 PsiBlast_CBE 95.7357%-104 - C6 -4I7E - PFKA_GEOSE -
5 PsiBlast_PDB 95.7357%-101 - C6 -4I4I - PFKA_GEOSE -
11 PsiBlast_PDB 95.4357%-107 - C6 -1PFK 6.9 PFKA_ECOLI
40 PsiBlast_CBE 95.2457%-108 - C6 -1PFK 6.4 PFKA_ECOLI