@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1110: (2015-12-05 )
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDEFGVVSSRIGMRREAVPISDDMDIFSYIQNLPQKPYCVLIDECQFLSKKNVYDLARVVDDLDVPVMAFGLKNDFQNNLFEGSKHLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGDQIQIGGNETYIPVCRKHYFNPDI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_A_9(2QQ0)
KITH_THEMA
[Raw transfer]




THM_B_6(2QQE)
KITH_THEMA
[Raw transfer]




25 PsiBlast_CBE 93.1831%-108 - C3 -2ORW - KITH_THEMA -
1 PsiBlast_PDB 92.3028% -97 - C3 -2B8T - KITH_UREPA -
4 PsiBlast_PDB 91.2931%-104 - C3 -2QQ0 7.3 KITH_THEMA
3 PsiBlast_PDB 90.6931%-113 - C3 -2QPO - KITH_THEMA -
43 HHSearch 90.4828% -91 - C3 -2B8T - KITH_UREPA -
23 PsiBlast_CBE 89.7231%-118 - C3 -2QPO - KITH_THEMA -
21 PsiBlast_CBE 88.2831%-114 - C3 -2QQE 6.0 KITH_THEMA
24 PsiBlast_CBE 88.0831%-115 - C3 -2QPO - KITH_THEMA -
22 PsiBlast_CBE 87.2331%-104 - C3 -2QQ0 - KITH_THEMA -
6 PsiBlast_PDB 86.7026% -83 - C3 -2JA1 - KITH_BACCR -
5 PsiBlast_PDB 86.6331%-103 - C3 -2QQE - KITH_THEMA -
46 HHSearch 86.4131%-102 * C3 *2ORW - KITH_THEMA -
45 HHSearch 85.7827% -93 - C3 -1XX6 - KITH_CLOAB -
13 PsiBlast_PDB 83.6824%-100 - C3 -1XBT - KITH_HUMAN -
2 PsiBlast_PDB 83.5231%-102 - C3 -2ORW - KITH_THEMA -
48 HHSearch 83.2025% -96 - C3 -2J9R - KITH_BACAN -
7 PsiBlast_PDB 82.8526% -98 - C3 -2J9R - KITH_BACAN -
15 PsiBlast_PDB 82.4924% -99 - C3 -2WVJ - KITH_HUMAN -
12 PsiBlast_PDB 81.6724%-101 - C3 -1W4R - KITH_HUMAN -
14 PsiBlast_PDB 80.6724%-102 - C3 -2ORV - KITH_HUMAN -