@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1160: (2015-12-05 )
MKFEYIAEERCKVKTLLKSHDVSRGLLAKIKYRGGKIFVNGEEQNAIFLLEIGDVVTIDIPDEPSHETLEPVPHDLDIVYEDDHFLILNKPFGFASIPSSIHSNTIANFIKHYYVSNNYANQQVHIVTRLDRDTSGLMLFAKHGYAHARLDKQLQAKAIEKRYYALVSGSGDLADSGDIIAPIARDVDSIITRRVHESGKYAHTSYQVVARYGDVRLVDIKLHTGRTHQIRVHFAHIGFPLLGDDLYGGRMDLGINRQALHCHSLSFYDPFMGKINKQTLDLTDDFDSVIMELH

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACY_G_7(1XPI)
RLUC_ECOLI
[Raw transfer]




FOU_E_9(2I82)
RLUA_ECOLI
[Raw transfer]




FOU_E_9(2I82)
RLUA_ECOLI
[Raw transfer]




39 Fugue 98.8833%-103 - C5 -2IST - RLUD_ECOLI -
19 HHSearch 89.0533%-101 - C5 -1V9F - RLUD_ECOLI -
2 PsiBlast_PDB 85.4037% -93 - C5 -2IST - RLUD_ECOLI -
1 PsiBlast_PDB 85.1337% -94 - C5 -1V9F - RLUD_ECOLI -
18 PsiBlast_CBE 84.4034%-105 - C5 -1XPI 2.4 RLUC_ECOLI
5 PsiBlast_PDB 84.0134%-109 - C5 -1XPI - RLUC_ECOLI -
20 HHSearch 83.7736% -98 - C5 -1V9K - RLUC_ECOLI -
7 PsiBlast_PDB 79.9133%-106 - C5 -2I82 4.3 RLUA_ECOLI
6 PsiBlast_PDB 79.5036%-100 - C5 -1V9K - RLUC_ECOLI -
21 HHSearch 76.3632% -92 - C5 -2I82 4.3 RLUA_ECOLI
4 PsiBlast_PDB 61.4236% -44 - C5 -1PRZ - RLUD_ECOLI -
3 PsiBlast_PDB 60.0136% -45 - C5 -1QYU - RLUD_ECOLI -
15 PsiBlast_PDB 59.7726% -79 - C5 -1KSV - RSUA_ECOLI -
23 HHSearch 59.6023% -73 - C5 -1KSK - RSUA_ECOLI -
41 Fugue 59.3220% -89 - C5 -1KSK - RSUA_ECOLI -
24 HHSearch 59.3023% -69 - C5 -3DH3 - RLUF_ECOLI -
14 PsiBlast_PDB 59.1326% -74 - C5 -1KSL - RSUA_ECOLI -
13 PsiBlast_PDB 58.6326% -75 - C5 -1KSK - RSUA_ECOLI -
22 HHSearch 56.4722% -77 * C5 *1VIO - RSUA_HAEIN -
27 HHSearch 49.9424% -84 - C5 -2GML - RLUF_ECOLI -