@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1199: (2015-12-06 )
MDLFLSLERKFKAASDKEVSKQQEAYLRHHFKCYGIKSPERRMLYKELIKAAKRQAKIDWQLLDKCWQSDYREYHHFVLDYLLAMSQFLTYNDCSRLEFYARHQQWWDSIDVLTKIFGNLSLKDDKVMNLLSEWSLDQDFWMRRLAIEHQLGFKEKTNTDILSLFILRNTGSQEFFINKAIGWALRDYSKYNKVWVKDFISNHYDELSTLSIREGSKYL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_B_2(3JXZ)
?
[Raw transfer]

-

NACID_B_2(3JY1)
?
[Raw transfer]

-

NACID_B_2(3JX7)
?
[Raw transfer]

-

NACID_B_2(3JXY)
?
[Raw transfer]

-

1 PsiBlast_PDB 97.2336% -88 - C1 -2B6C - ? -
2 PsiBlast_PDB 91.6631% -78 - C1 -3JXZ 3.7 ?
4 PsiBlast_PDB 91.3531% -74 - C1 -3BVS - ? -
21 HHSearch 91.2631% -85 - C1 -2B6C - ? -
3 PsiBlast_PDB 91.0631% -74 - C1 -3JY1 3.1 ?
6 PsiBlast_PDB 89.7931% -74 - C1 -3JXY 3.6 ?
5 PsiBlast_PDB 89.7131% -75 - C1 -3JX7 2.2 ?
23 HHSearch 65.7223% -77 - C1 -3L9T - ? -
47 Fugue 63.9211% -73 - C1 -1T06 - ? -
22 HHSearch 56.258% -49 - C1 -3ZBO - ? -
46 Fugue 54.2720% -33 - C1 -4D0Y - ? -
49 Fugue 52.5716% -62 - C1 -1KC6 - T2C2_HAEIF -
30 HHSearch 52.3912% -83 - C1 -2VGL - AP2B1_HUMAN -
44 Fugue 49.3113% -59 - C1 -1WPB - ? -
24 HHSearch 47.6613% -69 - C1 -3TJZ - COPG1_BOVIN -
28 HHSearch 43.7114% -57 - C1 -1TE4 - ? -
35 HHSearch 43.249% -37 - C1 -2DB0 - ? -
25 HHSearch 42.989% -52 - C1 -2DB0 - ? -
43 Fugue 41.2712% -65 - C1 -2OCA - UVSW_BPT4 -
26 HHSearch 41.2119% -36 - C1 -3L9T - ? -