@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1245: (2015-12-06 )
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTTSTSLALSLAQAGFKTLLIDADTRNSVMSGTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVVDAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVNESVATYGDYGDYGNYGKRDRKRK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_6(3BFV)
CAP8A_STAAU
[Raw transfer]




ADP_A_5(3BFV)
CAP8A_STAAU
[Raw transfer]




1 PsiBlast_PDB 94.0838%-107 - C2 -4JLV - ? -
23 PsiBlast_CBE 93.0033%-105 - C2 -3CIO - -
6 PsiBlast_PDB 91.3133%-102 - C2 -3CIO - ETK_ECOLI -
88 HHSearch 91.0933% -96 - C2 -3CIO - ETK_ECOLI -
77 Fugue 90.4031% -96 - C2 -3CIO - ETK_ECOLI -
3 PsiBlast_PDB 89.5633%-114 - C2 -4JMP - ? -
2 PsiBlast_PDB 89.0633%-111 - C2 -3BFV 6.0 CAP8A_STAAU
21 PsiBlast_CBE 88.8033%-111 - C2 -3BFV 6.3 CAP8A_STAAU
4 PsiBlast_PDB 88.5833%-113 - C2 -2VED - ? -
5 PsiBlast_PDB 88.0830%-100 - C2 -3LA6 - WZC_ECOLI -
22 PsiBlast_CBE 87.4433%-109 - C2 -2VED - ? -
87 HHSearch 85.4828%-105 - C2 -3LA6 - WZC_ECOLI -
8 PsiBlast_PDB 73.0727% -94 - C2 -1G3Q - ? -
82 Fugue 72.8223% -96 - C2 -3K9G - ? -
89 HHSearch 72.6925% -92 - C2 -1G3Q - ? -
9 PsiBlast_PDB 72.0327% -93 - C2 -1G3R - ? -
7 PsiBlast_PDB 70.8227% -87 - C2 -1ION - ? -
94 HHSearch 69.7720% -91 * C2 *3Q9L - MIND_ECOLI -
95 HHSearch 67.7721%-100 - C2 -2OZE - ? -
81 Fugue 66.7621% -95 - C2 -2OZE - ? -