@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1394: (2015-12-07 )
MVKVQTGGKLYIAGEYAILYPGQVAILKNIPIYMTALATFADNYSLYSDMFNYTASLQPDKQYSLIQETILLMEEWLINFGKNIKPIHLEITGKLERYGLKFGIGSSGSVVVLTIKAMAALYEIEMPSDLLFKLSAYVLLKRGDNGSMGDIACIAYEHLISYSAFDRRAVSKMIETKPLEQVLEAEWGYRITKIQASLEMDFLVGWTMQPSISKEMINIVKSTITQRFLDDTNYQVVQLLSAFKEGDKEAIKRCLEEISLLLFNLHPSIYTDKLQKLKEASKGLDIVTKSSGSGGGDCGIAISFNKNDNQTLIKRWESAGIELLSKETLS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_A_3(3GON)
?
[Raw transfer]




ANP_A_3(3GON)
?
[Raw transfer]




1 PsiBlast_PDB 99.9852%-116 - C4 -3GON 6.1 ?
17 HHSearch 97.0952%-114 - C4 -3GON 6.1 ?
2 PsiBlast_PDB 81.1430% -97 - C4 -3K17 - ? -
18 HHSearch 80.7829%-101 - C4 -3K17 - ? -
28 HHSearch 67.5919% -99 - C4 -2CZ9 - GAL1_PYRHO -
21 HHSearch 64.0921% -87 - C4 -1KKH - MVK_METJA -
23 HHSearch 62.5216%-105 - C4 -1KVK - KIME_RAT -
24 HHSearch 62.1522% -83 - C4 -2OI2 - ? -
25 HHSearch 61.5718% -86 - C4 -1PIE - GAL1_LACLA -
42 Fugue 59.5721% -72 - C4 -2OI2 - ? -
44 Fugue 59.5015% -82 - C4 -1H74 - KHSE_METJA -
31 HHSearch 58.5015% -80 * C4 *1H72 - KHSE_METJA -
46 Fugue 57.6215% -79 - C4 -1FWK - KHSE_METJA -
37 HHSearch 57.2414% -92 - C4 -3QT5 - ? -
27 HHSearch 56.2911% -81 - C4 -1WUU - GALK1_HUMAN -
43 Fugue 55.9512% -71 - C4 -1H72 - KHSE_METJA -
36 HHSearch 55.7713% -86 - C4 -2GS8 - ? -
32 HHSearch 55.4615% -79 - C4 -3PYF - ISPE_MYCTU -
45 Fugue 54.4516% -57 - C4 -1PIE - GAL1_LACLA -
41 Fugue 54.2216% -76 - C4 -1KVK - KIME_RAT -