@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1450: (2015-12-08 )
MNKLKVNSVVERKIKSGAQLLEKKDFDTSLVNQLVQLFSQSNQFLGMAYLSPQNKGIGWLLSRQVFDFNHDYFVSLFEKSREKRQKFEKFSQTTAYRLFNQDGDNFGGLTIDFYSDYALFSWYNEFVYTNRQMIVAAFKQVYPNIKGAYEKIRFKGLDFESAHLYGQEAPESFLILENNIKYSVFLNDGLMTGIFLDQHDVRKALATNLSEGKKVLNMFSYTAAFSVAAAVGGALETTSVDLAKRSRELSKAHFDANQIVTDNHRFIVMDVFEYYKYAKRKHLSYDVIVIDPPSFARNKKQTFSVTKDYYKLIEQALDILTPGGTIIASTNAANLTVSQFKKQLEKGFGKASHNYISLQQLPEDFTVNDKDQQSNYLKVFTIKVK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAH_A_2(3LDF)
?
[Raw transfer]




48 Fugue 98.4567% -92 - C1 -3LDF 7.9 ?
50 Fugue 96.5966% -87 - C1 -2B78 - ? -
27 HHSearch 85.4142% -81 - C1 -3VSE - ? -
49 Fugue 85.1441% -81 - C1 -3VSE - ? -
22 PsiBlast_CBE 84.3441% -81 - C1 -3VSE - ? -
1 PsiBlast_PDB 83.7941% -80 - C1 -3VSE - ? -
21 PsiBlast_CBE 83.2941% -80 - C1 -3VSE - ? -
23 PsiBlast_CBE 82.2241% -78 - C1 -3VSE - ? -
51 Fugue 66.5920% -70 - C1 -2CWW - ? -
9 PsiBlast_PDB 65.9820% -80 - C1 -4DMG - ? -
55 Fugue 65.6325% -70 - C1 -3V97 - RLMKL_ECOLI -
52 Fugue 63.4519% -66 - C1 -1WXW - ? -
30 HHSearch 62.4328% -74 - C1 -3V97 - RLMKL_ECOLI -
24 PsiBlast_CBE 61.9731%-101 - C1 -3V8V - RLMKL_ECOLI -
25 PsiBlast_CBE 61.7631%-102 - C1 -3V97 - RLMKL_ECOLI -
4 PsiBlast_PDB 60.4531% -94 - C1 -3V8V - RLMKL_ECOLI -
5 PsiBlast_PDB 60.4231% -95 - C1 -3V97 - RLMKL_ECOLI -
8 PsiBlast_PDB 59.8422% -56 - C1 -1WXX - ? -
6 PsiBlast_PDB 59.6222% -56 - C1 -2CWW - ? -
7 PsiBlast_PDB 58.7422% -52 - C1 -1WXW - ? -