@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1538: (2015-12-08 )
MVLQDFDNLLKKYAQLIISKGLNVQKGHTLALTIDVEQVHLARLLTEAAYEKGASEVIVDYTDDFITRQRLLHASDEVLTNVPQYTVDKSLALLNKKASRLVVKSSNPNAFATVDPKRLSETTRATAIALEEQSRAIQANKVSWNVAAAAGREWAALVFPELKTSDQQVDALWDTIFKLNRIYEDDPIAAWDAHEAKLLEKATRLNQEQFDALHYTAPGTDLTLGMPKNHIWEAAGSLNAQGETFIANMPTEEIFSAPDYRRADGYVTSTKPLSYAGVIIENMTFTFKDGKIINVTAEKGQETVQRLIEENDGARSLGEVALVPHKTPISLSGLIFFNTLFDENASNHLAIGSAYAFNVEGGTEMTSQELDEAGLNRSSTHVDFMIGSEQMDIDGIRADGTAVPIFRNGEWAI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRP_B_9(4ICS)
?
[Raw transfer]




TRP_A_5(4ICS)
?
[Raw transfer]




GLY_B_10(4ICS)
?
[Raw transfer]




GLY_A_6(4ICS)
?
[Raw transfer]




3 PsiBlast_PDB 93.3461% -67 - C5 -4ICS 4.7 ?
1 PsiBlast_PDB 93.3462% -69 - C5 -4ICQ - ? -
15 PsiBlast_CBE 92.5861% -67 - C5 -4ICS 3.4 ?
14 PsiBlast_CBE 92.3462% -70 - C5 -4ICQ - ? -
2 PsiBlast_PDB 91.6261% -73 - C5 -4ICR - ? -
16 PsiBlast_CBE 90.8961% -72 - C5 -4ICR - ? -
4 PsiBlast_PDB 85.6043% -66 - C5 -1ZJC - ? -
31 Fugue 85.5844% -69 * C5 *1ZJC - ? -
21 HHSearch 85.4244% -65 - C5 -1ZJC - ? -
18 PsiBlast_CBE 81.2240% -67 - C5 -2AYI - AMPT_THET8 -
19 PsiBlast_CBE 81.2140% -68 - C5 -2AYI - AMPT_THET8 -
5 PsiBlast_PDB 81.1640% -69 - C5 -2AYI - AMPT_THET8 -
22 HHSearch 80.7840% -68 - C5 -2AYI - AMPT_THET8 -
17 PsiBlast_CBE 80.3740% -67 - C5 -2AYI - AMPT_THET8 -
20 PsiBlast_CBE 80.0340% -66 - C5 -2AYI - AMPT_THET8 -
35 Fugue 42.2217% -28 - C6 -3ALX - HEMA_MEASE -
38 Fugue 41.7124% -27 * C6 *3NO2 - ? -
32 Fugue 41.6720% -9 - C5 -4R33 - ? -
40 Fugue 36.5115% -26 - C1 -3PV2 - ? -
37 Fugue 34.3315% -20 - C6 -1FIU - T2M4_NEIGO -